Release Notes For GenBank Release 262
GBREL.TXT Genetic Sequence Data Bank
August 15 2024
NCBI-GenBank Flat File Release 262.0
Distribution Release Notes
251998350 sequences, 3675462701077 bases, for traditional GenBank records
4512944732 sequences, 30426706177141 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 262.0
1.2 Cutoff Date
1.3 Important Changes in Release 262.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 262.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
Email: [email protected]
Updates and changes to existing GenBank records:
https://www.ncbi.nlm.nih.gov/genbank/update/
Email: [email protected]
URLs for GenBank's web-based submission tools:
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
See Section 1.5 for additional details about submitting data to GenBank.
*****************************************************************************
GenBank Release 262.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
1.2 Cutoff Date
This full release, 262.0, incorporates data processed by the INSDC databases
as of Friday August 16 9:57PM EDT. For more recent data, users are
advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 262.0
1.3.1 Organizational changes
The total number of sequence data files for traditional GenBank records
(non-WGS/TSA/TLS) increased by 346 with this release:
- the BCT division is now composed of 505 files (+16)
- the ENV division is now composed of 40 files (+2)
- the INV division is now composed of 1138 files (+61)
- the MAM division is now composed of 193 files (+33)
- the PAT division is now composed of 110 files (+1)
- the PLN division is now composed of 1806 files (+145)
- the ROD division is now composed of 131 files (+11)
- the VRL division is now composed of 504 files (+4)
- the VRT division is now composed of 335 files (+73)
1.4 Upcoming Changes
1.4.1 New allowed values for the /geo_loc_name and /collection_date qualifiers
The INSDC will begin to mandate inclusion of /geo_loc_name (formerly /country)
and /collection_date for sequence submissions, in alignment with its goal of
increasing the number of sequences for which the origin of a sample can be
precisely located in time and space. This requirement is expected to take
effect by the end of December 2024, and further details can be found at:
https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/
Because there are valid circumstances in which location and/or the
collection date for a sequenced sample cannot be provided, the domain
of allowed values for these two source-feature qualifiers will be expanded
to include a variety of "null terms". They are:
missing
not applicable
not collected
not provided
restricted access
missing: control sample
missing: sample group
missing: synthetic construct
missing: lab stock
missing: third party data
missing: data agreement established pre-2023
missing: endangered species
missing: human-identifiable
The timeframe for introducing these new values is still uncertain, but the
earliest possible date for their appearance was June 15 2023, and they will
definitely be encountered after Dec 31 2024, when /geo_loc_name and
/collection_date have become mandatory.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:
https://www.ncbi.nlm.nih.gov/genbank/submit/
To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).
BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.
Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to [email protected] when relevant:
table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/
table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:
https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/
Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.
Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/
Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
SEQUIN. As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI. See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 5374 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct51.seq - Bacterial sequence entries, part 51.
454. gbbct52.seq - Bacterial sequence entries, part 52.
455. gbbct53.seq - Bacterial sequence entries, part 53.
456. gbbct54.seq - Bacterial sequence entries, part 54.
457. gbbct55.seq - Bacterial sequence entries, part 55.
458. gbbct56.seq - Bacterial sequence entries, part 56.
459. gbbct57.seq - Bacterial sequence entries, part 57.
460. gbbct58.seq - Bacterial sequence entries, part 58.
461. gbbct59.seq - Bacterial sequence entries, part 59.
462. gbbct6.seq - Bacterial sequence entries, part 6.
463. gbbct60.seq - Bacterial sequence entries, part 60.
464. gbbct61.seq - Bacterial sequence entries, part 61.
465. gbbct62.seq - Bacterial sequence entries, part 62.
466. gbbct63.seq - Bacterial sequence entries, part 63.
467. gbbct64.seq - Bacterial sequence entries, part 64.
468. gbbct65.seq - Bacterial sequence entries, part 65.
469. gbbct66.seq - Bacterial sequence entries, part 66.
470. gbbct67.seq - Bacterial sequence entries, part 67.
471. gbbct68.seq - Bacterial sequence entries, part 68.
472. gbbct69.seq - Bacterial sequence entries, part 69.
473. gbbct7.seq - Bacterial sequence entries, part 7.
474. gbbct70.seq - Bacterial sequence entries, part 70.
475. gbbct71.seq - Bacterial sequence entries, part 71.
476. gbbct72.seq - Bacterial sequence entries, part 72.
477. gbbct73.seq - Bacterial sequence entries, part 73.
478. gbbct74.seq - Bacterial sequence entries, part 74.
479. gbbct75.seq - Bacterial sequence entries, part 75.
480. gbbct76.seq - Bacterial sequence entries, part 76.
481. gbbct77.seq - Bacterial sequence entries, part 77.
482. gbbct78.seq - Bacterial sequence entries, part 78.
483. gbbct79.seq - Bacterial sequence entries, part 79.
484. gbbct8.seq - Bacterial sequence entries, part 8.
485. gbbct80.seq - Bacterial sequence entries, part 80.
486. gbbct81.seq - Bacterial sequence entries, part 81.
487. gbbct82.seq - Bacterial sequence entries, part 82.
488. gbbct83.seq - Bacterial sequence entries, part 83.
489. gbbct84.seq - Bacterial sequence entries, part 84.
490. gbbct85.seq - Bacterial sequence entries, part 85.
491. gbbct86.seq - Bacterial sequence entries, part 86.
492. gbbct87.seq - Bacterial sequence entries, part 87.
493. gbbct88.seq - Bacterial sequence entries, part 88.
494. gbbct89.seq - Bacterial sequence entries, part 89.
495. gbbct9.seq - Bacterial sequence entries, part 9.
496. gbbct90.seq - Bacterial sequence entries, part 90.
497. gbbct91.seq - Bacterial sequence entries, part 91.
498. gbbct92.seq - Bacterial sequence entries, part 92.
499. gbbct93.seq - Bacterial sequence entries, part 93.
500. gbbct94.seq - Bacterial sequence entries, part 94.
501. gbbct95.seq - Bacterial sequence entries, part 95.
502. gbbct96.seq - Bacterial sequence entries, part 96.
503. gbbct97.seq - Bacterial sequence entries, part 97.
504. gbbct98.seq - Bacterial sequence entries, part 98.
505. gbbct99.seq - Bacterial sequence entries, part 99.
506. gbchg.txt - Accession numbers of entries updated since the previous release.
507. gbcon1.seq - Constructed sequence entries, part 1.
508. gbcon10.seq - Constructed sequence entries, part 10.
509. gbcon100.seq - Constructed sequence entries, part 100.
510. gbcon101.seq - Constructed sequence entries, part 101.
511. gbcon11.seq - Constructed sequence entries, part 11.
512. gbcon12.seq - Constructed sequence entries, part 12.
513. gbcon13.seq - Constructed sequence entries, part 13.
514. gbcon14.seq - Constructed sequence entries, part 14.
515. gbcon15.seq - Constructed sequence entries, part 15.
516. gbcon16.seq - Constructed sequence entries, part 16.
517. gbcon17.seq - Constructed sequence entries, part 17.
518. gbcon18.seq - Constructed sequence entries, part 18.
519. gbcon19.seq - Constructed sequence entries, part 19.
520. gbcon2.seq - Constructed sequence entries, part 2.
521. gbcon20.seq - Constructed sequence entries, part 20.
522. gbcon21.seq - Constructed sequence entries, part 21.
523. gbcon22.seq - Constructed sequence entries, part 22.
524. gbcon23.seq - Constructed sequence entries, part 23.
525. gbcon24.seq - Constructed sequence entries, part 24.
526. gbcon25.seq - Constructed sequence entries, part 25.
527. gbcon26.seq - Constructed sequence entries, part 26.
528. gbcon27.seq - Constructed sequence entries, part 27.
529. gbcon28.seq - Constructed sequence entries, part 28.
530. gbcon29.seq - Constructed sequence entries, part 29.
531. gbcon3.seq - Constructed sequence entries, part 3.
532. gbcon30.seq - Constructed sequence entries, part 30.
533. gbcon31.seq - Constructed sequence entries, part 31.
534. gbcon32.seq - Constructed sequence entries, part 32.
535. gbcon33.seq - Constructed sequence entries, part 33.
536. gbcon34.seq - Constructed sequence entries, part 34.
537. gbcon35.seq - Constructed sequence entries, part 35.
538. gbcon36.seq - Constructed sequence entries, part 36.
539. gbcon37.seq - Constructed sequence entries, part 37.
540. gbcon38.seq - Constructed sequence entries, part 38.
541. gbcon39.seq - Constructed sequence entries, part 39.
542. gbcon4.seq - Constructed sequence entries, part 4.
543. gbcon40.seq - Constructed sequence entries, part 40.
544. gbcon41.seq - Constructed sequence entries, part 41.
545. gbcon42.seq - Constructed sequence entries, part 42.
546. gbcon43.seq - Constructed sequence entries, part 43.
547. gbcon44.seq - Constructed sequence entries, part 44.
548. gbcon45.seq - Constructed sequence entries, part 45.
549. gbcon46.seq - Constructed sequence entries, part 46.
550. gbcon47.seq - Constructed sequence entries, part 47.
551. gbcon48.seq - Constructed sequence entries, part 48.
552. gbcon49.seq - Constructed sequence entries, part 49.
553. gbcon5.seq - Constructed sequence entries, part 5.
554. gbcon50.seq - Constructed sequence entries, part 50.
555. gbcon51.seq - Constructed sequence entries, part 51.
556. gbcon52.seq - Constructed sequence entries, part 52.
557. gbcon53.seq - Constructed sequence entries, part 53.
558. gbcon54.seq - Constructed sequence entries, part 54.
559. gbcon55.seq - Constructed sequence entries, part 55.
560. gbcon56.seq - Constructed sequence entries, part 56.
561. gbcon57.seq - Constructed sequence entries, part 57.
562. gbcon58.seq - Constructed sequence entries, part 58.
563. gbcon59.seq - Constructed sequence entries, part 59.
564. gbcon6.seq - Constructed sequence entries, part 6.
565. gbcon60.seq - Constructed sequence entries, part 60.
566. gbcon61.seq - Constructed sequence entries, part 61.
567. gbcon62.seq - Constructed sequence entries, part 62.
568. gbcon63.seq - Constructed sequence entries, part 63.
569. gbcon64.seq - Constructed sequence entries, part 64.
570. gbcon65.seq - Constructed sequence entries, part 65.
571. gbcon66.seq - Constructed sequence entries, part 66.
572. gbcon67.seq - Constructed sequence entries, part 67.
573. gbcon68.seq - Constructed sequence entries, part 68.
574. gbcon69.seq - Constructed sequence entries, part 69.
575. gbcon7.seq - Constructed sequence entries, part 7.
576. gbcon70.seq - Constructed sequence entries, part 70.
577. gbcon71.seq - Constructed sequence entries, part 71.
578. gbcon72.seq - Constructed sequence entries, part 72.
579. gbcon73.seq - Constructed sequence entries, part 73.
580. gbcon74.seq - Constructed sequence entries, part 74.
581. gbcon75.seq - Constructed sequence entries, part 75.
582. gbcon76.seq - Constructed sequence entries, part 76.
583. gbcon77.seq - Constructed sequence entries, part 77.
584. gbcon78.seq - Constructed sequence entries, part 78.
585. gbcon79.seq - Constructed sequence entries, part 79.
586. gbcon8.seq - Constructed sequence entries, part 8.
587. gbcon80.seq - Constructed sequence entries, part 80.
588. gbcon81.seq - Constructed sequence entries, part 81.
589. gbcon82.seq - Constructed sequence entries, part 82.
590. gbcon83.seq - Constructed sequence entries, part 83.
591. gbcon84.seq - Constructed sequence entries, part 84.
592. gbcon85.seq - Constructed sequence entries, part 85.
593. gbcon86.seq - Constructed sequence entries, part 86.
594. gbcon87.seq - Constructed sequence entries, part 87.
595. gbcon88.seq - Constructed sequence entries, part 88.
596. gbcon89.seq - Constructed sequence entries, part 89.
597. gbcon9.seq - Constructed sequence entries, part 9.
598. gbcon90.seq - Constructed sequence entries, part 90.
599. gbcon91.seq - Constructed sequence entries, part 91.
600. gbcon92.seq - Constructed sequence entries, part 92.
601. gbcon93.seq - Constructed sequence entries, part 93.
602. gbcon94.seq - Constructed sequence entries, part 94.
603. gbcon95.seq - Constructed sequence entries, part 95.
604. gbcon96.seq - Constructed sequence entries, part 96.
605. gbcon97.seq - Constructed sequence entries, part 97.
606. gbcon98.seq - Constructed sequence entries, part 98.
607. gbcon99.seq - Constructed sequence entries, part 99.
608. gbdel.txt - Accession numbers of entries deleted since the previous release.
609. gbenv1.seq - Environmental sampling sequence entries, part 1.
610. gbenv10.seq - Environmental sampling sequence entries, part 10.
611. gbenv11.seq - Environmental sampling sequence entries, part 11.
612. gbenv12.seq - Environmental sampling sequence entries, part 12.
613. gbenv13.seq - Environmental sampling sequence entries, part 13.
614. gbenv14.seq - Environmental sampling sequence entries, part 14.
615. gbenv15.seq - Environmental sampling sequence entries, part 15.
616. gbenv16.seq - Environmental sampling sequence entries, part 16.
617. gbenv17.seq - Environmental sampling sequence entries, part 17.
618. gbenv18.seq - Environmental sampling sequence entries, part 18.
619. gbenv19.seq - Environmental sampling sequence entries, part 19.
620. gbenv2.seq - Environmental sampling sequence entries, part 2.
621. gbenv20.seq - Environmental sampling sequence entries, part 20.
622. gbenv21.seq - Environmental sampling sequence entries, part 21.
623. gbenv22.seq - Environmental sampling sequence entries, part 22.
624. gbenv23.seq - Environmental sampling sequence entries, part 23.
625. gbenv24.seq - Environmental sampling sequence entries, part 24.
626. gbenv25.seq - Environmental sampling sequence entries, part 25.
627. gbenv26.seq - Environmental sampling sequence entries, part 26.
628. gbenv27.seq - Environmental sampling sequence entries, part 27.
629. gbenv28.seq - Environmental sampling sequence entries, part 28.
630. gbenv29.seq - Environmental sampling sequence entries, part 29.
631. gbenv3.seq - Environmental sampling sequence entries, part 3.
632. gbenv30.seq - Environmental sampling sequence entries, part 30.
633. gbenv31.seq - Environmental sampling sequence entries, part 31.
634. gbenv32.seq - Environmental sampling sequence entries, part 32.
635. gbenv33.seq - Environmental sampling sequence entries, part 33.
636. gbenv34.seq - Environmental sampling sequence entries, part 34.
637. gbenv35.seq - Environmental sampling sequence entries, part 35.
638. gbenv36.seq - Environmental sampling sequence entries, part 36.
639. gbenv37.seq - Environmental sampling sequence entries, part 37.
640. gbenv38.seq - Environmental sampling sequence entries, part 38.
641. gbenv39.seq - Environmental sampling sequence entries, part 39.
642. gbenv4.seq - Environmental sampling sequence entries, part 4.
643. gbenv40.seq - Environmental sampling sequence entries, part 40.
644. gbenv5.seq - Environmental sampling sequence entries, part 5.
645. gbenv6.seq - Environmental sampling sequence entries, part 6.
646. gbenv7.seq - Environmental sampling sequence entries, part 7.
647. gbenv8.seq - Environmental sampling sequence entries, part 8.
648. gbenv9.seq - Environmental sampling sequence entries, part 9.
649. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
650. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
651. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
652. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
653. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
654. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
655. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
656. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
657. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
658. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
659. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
660. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
661. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
662. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
663. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
664. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
665. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
666. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
667. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
668. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
669. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
670. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
671. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
672. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
673. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
674. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
675. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
676. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
677. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
678. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
679. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
680. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
681. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
682. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
683. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
684. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
685. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
686. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
687. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
688. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
689. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
690. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
691. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
692. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
693. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
694. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
695. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
696. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
697. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
698. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
699. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
700. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
701. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
702. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
703. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
704. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
705. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
706. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
707. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
708. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
709. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
710. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
711. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
712. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
713. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
714. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
715. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
716. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
717. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
718. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
719. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
720. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
721. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
722. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
723. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
724. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
725. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
726. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
727. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
728. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
729. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
730. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
731. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
732. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
733. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
734. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
735. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
736. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
737. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
738. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
739. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
740. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
741. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
742. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
743. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
744. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
745. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
746. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
747. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
748. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
749. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
750. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
751. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
752. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
753. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
754. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
755. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
756. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
757. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
758. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
759. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
760. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
761. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
762. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
763. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
764. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
765. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
766. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
767. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
768. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
769. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
770. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
771. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
772. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
773. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
774. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
775. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
776. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
777. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
778. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
779. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
780. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
781. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
782. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
783. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
784. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
785. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
786. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
787. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
788. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
789. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
790. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
791. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
792. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
793. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
794. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
795. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
796. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
797. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
798. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
799. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
800. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
801. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
802. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
803. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
804. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
805. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
806. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
807. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
808. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
809. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
810. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
811. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
812. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
813. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
814. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
815. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
816. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
817. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
818. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
819. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
820. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
821. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
822. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
823. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
824. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
825. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
826. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
827. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
828. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
829. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
830. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
831. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
832. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
833. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
834. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
835. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
836. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
837. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
838. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
839. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
840. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
841. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
842. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
843. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
844. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
845. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
846. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
847. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
848. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
849. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
850. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
851. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
852. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
853. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
854. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
855. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
856. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
857. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
858. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
859. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
860. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
861. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
862. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
863. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
864. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
865. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
866. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
867. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
868. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
869. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
870. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
871. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
872. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
873. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
874. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
875. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
876. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
877. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
878. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
879. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
880. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
881. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
882. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
883. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
884. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
885. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
886. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
887. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
888. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
889. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
890. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
891. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
892. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
893. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
894. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
895. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
896. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
897. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
898. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
899. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
900. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
901. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
902. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
903. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
904. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
905. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
906. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
907. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
908. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
909. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
910. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
911. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
912. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
913. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
914. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
915. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
916. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
917. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
918. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
919. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
920. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
921. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
922. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
923. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
924. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
925. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
926. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
927. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
928. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
929. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
930. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
931. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
932. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
933. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
934. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
935. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
936. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
937. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
938. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
939. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
940. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
941. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
942. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
943. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
944. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
945. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
946. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
947. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
948. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
949. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
950. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
951. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
952. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
953. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
954. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
955. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
956. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
957. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
958. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
959. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
960. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
961. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
962. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
963. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
964. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
965. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
966. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
967. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
968. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
969. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
970. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
971. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
972. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
973. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
974. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
975. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
976. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
977. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
978. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
979. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
980. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
981. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
982. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
983. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
984. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
985. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
986. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
987. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
988. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
989. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
990. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
991. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
992. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
993. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
994. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
995. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
996. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
997. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
998. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
999. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1000. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1001. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1002. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1003. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1004. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1005. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1006. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1007. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1008. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1009. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1010. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1011. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1012. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1013. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1014. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1015. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1016. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1017. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1018. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1019. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1020. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1021. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1022. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1023. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1024. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1025. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1026. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1027. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1028. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1029. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1030. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1031. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1032. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1033. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1034. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1035. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1036. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1037. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1038. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1039. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1040. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1041. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1042. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1043. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1044. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1045. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1046. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1047. gbinv1.seq - Invertebrate sequence entries, part 1.
1048. gbinv10.seq - Invertebrate sequence entries, part 10.
1049. gbinv100.seq - Invertebrate sequence entries, part 100.
1050. gbinv1000.seq - Invertebrate sequence entries, part 1000.
1051. gbinv1001.seq - Invertebrate sequence entries, part 1001.
1052. gbinv1002.seq - Invertebrate sequence entries, part 1002.
1053. gbinv1003.seq - Invertebrate sequence entries, part 1003.
1054. gbinv1004.seq - Invertebrate sequence entries, part 1004.
1055. gbinv1005.seq - Invertebrate sequence entries, part 1005.
1056. gbinv1006.seq - Invertebrate sequence entries, part 1006.
1057. gbinv1007.seq - Invertebrate sequence entries, part 1007.
1058. gbinv1008.seq - Invertebrate sequence entries, part 1008.
1059. gbinv1009.seq - Invertebrate sequence entries, part 1009.
1060. gbinv101.seq - Invertebrate sequence entries, part 101.
1061. gbinv1010.seq - Invertebrate sequence entries, part 1010.
1062. gbinv1011.seq - Invertebrate sequence entries, part 1011.
1063. gbinv1012.seq - Invertebrate sequence entries, part 1012.
1064. gbinv1013.seq - Invertebrate sequence entries, part 1013.
1065. gbinv1014.seq - Invertebrate sequence entries, part 1014.
1066. gbinv1015.seq - Invertebrate sequence entries, part 1015.
1067. gbinv1016.seq - Invertebrate sequence entries, part 1016.
1068. gbinv1017.seq - Invertebrate sequence entries, part 1017.
1069. gbinv1018.seq - Invertebrate sequence entries, part 1018.
1070. gbinv1019.seq - Invertebrate sequence entries, part 1019.
1071. gbinv102.seq - Invertebrate sequence entries, part 102.
1072. gbinv1020.seq - Invertebrate sequence entries, part 1020.
1073. gbinv1021.seq - Invertebrate sequence entries, part 1021.
1074. gbinv1022.seq - Invertebrate sequence entries, part 1022.
1075. gbinv1023.seq - Invertebrate sequence entries, part 1023.
1076. gbinv1024.seq - Invertebrate sequence entries, part 1024.
1077. gbinv1025.seq - Invertebrate sequence entries, part 1025.
1078. gbinv1026.seq - Invertebrate sequence entries, part 1026.
1079. gbinv1027.seq - Invertebrate sequence entries, part 1027.
1080. gbinv1028.seq - Invertebrate sequence entries, part 1028.
1081. gbinv1029.seq - Invertebrate sequence entries, part 1029.
1082. gbinv103.seq - Invertebrate sequence entries, part 103.
1083. gbinv1030.seq - Invertebrate sequence entries, part 1030.
1084. gbinv1031.seq - Invertebrate sequence entries, part 1031.
1085. gbinv1032.seq - Invertebrate sequence entries, part 1032.
1086. gbinv1033.seq - Invertebrate sequence entries, part 1033.
1087. gbinv1034.seq - Invertebrate sequence entries, part 1034.
1088. gbinv1035.seq - Invertebrate sequence entries, part 1035.
1089. gbinv1036.seq - Invertebrate sequence entries, part 1036.
1090. gbinv1037.seq - Invertebrate sequence entries, part 1037.
1091. gbinv1038.seq - Invertebrate sequence entries, part 1038.
1092. gbinv1039.seq - Invertebrate sequence entries, part 1039.
1093. gbinv104.seq - Invertebrate sequence entries, part 104.
1094. gbinv1040.seq - Invertebrate sequence entries, part 1040.
1095. gbinv1041.seq - Invertebrate sequence entries, part 1041.
1096. gbinv1042.seq - Invertebrate sequence entries, part 1042.
1097. gbinv1043.seq - Invertebrate sequence entries, part 1043.
1098. gbinv1044.seq - Invertebrate sequence entries, part 1044.
1099. gbinv1045.seq - Invertebrate sequence entries, part 1045.
1100. gbinv1046.seq - Invertebrate sequence entries, part 1046.
1101. gbinv1047.seq - Invertebrate sequence entries, part 1047.
1102. gbinv1048.seq - Invertebrate sequence entries, part 1048.
1103. gbinv1049.seq - Invertebrate sequence entries, part 1049.
1104. gbinv105.seq - Invertebrate sequence entries, part 105.
1105. gbinv1050.seq - Invertebrate sequence entries, part 1050.
1106. gbinv1051.seq - Invertebrate sequence entries, part 1051.
1107. gbinv1052.seq - Invertebrate sequence entries, part 1052.
1108. gbinv1053.seq - Invertebrate sequence entries, part 1053.
1109. gbinv1054.seq - Invertebrate sequence entries, part 1054.
1110. gbinv1055.seq - Invertebrate sequence entries, part 1055.
1111. gbinv1056.seq - Invertebrate sequence entries, part 1056.
1112. gbinv1057.seq - Invertebrate sequence entries, part 1057.
1113. gbinv1058.seq - Invertebrate sequence entries, part 1058.
1114. gbinv1059.seq - Invertebrate sequence entries, part 1059.
1115. gbinv106.seq - Invertebrate sequence entries, part 106.
1116. gbinv1060.seq - Invertebrate sequence entries, part 1060.
1117. gbinv1061.seq - Invertebrate sequence entries, part 1061.
1118. gbinv1062.seq - Invertebrate sequence entries, part 1062.
1119. gbinv1063.seq - Invertebrate sequence entries, part 1063.
1120. gbinv1064.seq - Invertebrate sequence entries, part 1064.
1121. gbinv1065.seq - Invertebrate sequence entries, part 1065.
1122. gbinv1066.seq - Invertebrate sequence entries, part 1066.
1123. gbinv1067.seq - Invertebrate sequence entries, part 1067.
1124. gbinv1068.seq - Invertebrate sequence entries, part 1068.
1125. gbinv1069.seq - Invertebrate sequence entries, part 1069.
1126. gbinv107.seq - Invertebrate sequence entries, part 107.
1127. gbinv1070.seq - Invertebrate sequence entries, part 1070.
1128. gbinv1071.seq - Invertebrate sequence entries, part 1071.
1129. gbinv1072.seq - Invertebrate sequence entries, part 1072.
1130. gbinv1073.seq - Invertebrate sequence entries, part 1073.
1131. gbinv1074.seq - Invertebrate sequence entries, part 1074.
1132. gbinv1075.seq - Invertebrate sequence entries, part 1075.
1133. gbinv1076.seq - Invertebrate sequence entries, part 1076.
1134. gbinv1077.seq - Invertebrate sequence entries, part 1077.
1135. gbinv1078.seq - Invertebrate sequence entries, part 1078.
1136. gbinv1079.seq - Invertebrate sequence entries, part 1079.
1137. gbinv108.seq - Invertebrate sequence entries, part 108.
1138. gbinv1080.seq - Invertebrate sequence entries, part 1080.
1139. gbinv1081.seq - Invertebrate sequence entries, part 1081.
1140. gbinv1082.seq - Invertebrate sequence entries, part 1082.
1141. gbinv1083.seq - Invertebrate sequence entries, part 1083.
1142. gbinv1084.seq - Invertebrate sequence entries, part 1084.
1143. gbinv1085.seq - Invertebrate sequence entries, part 1085.
1144. gbinv1086.seq - Invertebrate sequence entries, part 1086.
1145. gbinv1087.seq - Invertebrate sequence entries, part 1087.
1146. gbinv1088.seq - Invertebrate sequence entries, part 1088.
1147. gbinv1089.seq - Invertebrate sequence entries, part 1089.
1148. gbinv109.seq - Invertebrate sequence entries, part 109.
1149. gbinv1090.seq - Invertebrate sequence entries, part 1090.
1150. gbinv1091.seq - Invertebrate sequence entries, part 1091.
1151. gbinv1092.seq - Invertebrate sequence entries, part 1092.
1152. gbinv1093.seq - Invertebrate sequence entries, part 1093.
1153. gbinv1094.seq - Invertebrate sequence entries, part 1094.
1154. gbinv1095.seq - Invertebrate sequence entries, part 1095.
1155. gbinv1096.seq - Invertebrate sequence entries, part 1096.
1156. gbinv1097.seq - Invertebrate sequence entries, part 1097.
1157. gbinv1098.seq - Invertebrate sequence entries, part 1098.
1158. gbinv1099.seq - Invertebrate sequence entries, part 1099.
1159. gbinv11.seq - Invertebrate sequence entries, part 11.
1160. gbinv110.seq - Invertebrate sequence entries, part 110.
1161. gbinv1100.seq - Invertebrate sequence entries, part 1100.
1162. gbinv1101.seq - Invertebrate sequence entries, part 1101.
1163. gbinv1102.seq - Invertebrate sequence entries, part 1102.
1164. gbinv1103.seq - Invertebrate sequence entries, part 1103.
1165. gbinv1104.seq - Invertebrate sequence entries, part 1104.
1166. gbinv1105.seq - Invertebrate sequence entries, part 1105.
1167. gbinv1106.seq - Invertebrate sequence entries, part 1106.
1168. gbinv1107.seq - Invertebrate sequence entries, part 1107.
1169. gbinv1108.seq - Invertebrate sequence entries, part 1108.
1170. gbinv1109.seq - Invertebrate sequence entries, part 1109.
1171. gbinv111.seq - Invertebrate sequence entries, part 111.
1172. gbinv1110.seq - Invertebrate sequence entries, part 1110.
1173. gbinv1111.seq - Invertebrate sequence entries, part 1111.
1174. gbinv1112.seq - Invertebrate sequence entries, part 1112.
1175. gbinv1113.seq - Invertebrate sequence entries, part 1113.
1176. gbinv1114.seq - Invertebrate sequence entries, part 1114.
1177. gbinv1115.seq - Invertebrate sequence entries, part 1115.
1178. gbinv1116.seq - Invertebrate sequence entries, part 1116.
1179. gbinv1117.seq - Invertebrate sequence entries, part 1117.
1180. gbinv1118.seq - Invertebrate sequence entries, part 1118.
1181. gbinv1119.seq - Invertebrate sequence entries, part 1119.
1182. gbinv112.seq - Invertebrate sequence entries, part 112.
1183. gbinv1120.seq - Invertebrate sequence entries, part 1120.
1184. gbinv1121.seq - Invertebrate sequence entries, part 1121.
1185. gbinv1122.seq - Invertebrate sequence entries, part 1122.
1186. gbinv1123.seq - Invertebrate sequence entries, part 1123.
1187. gbinv1124.seq - Invertebrate sequence entries, part 1124.
1188. gbinv1125.seq - Invertebrate sequence entries, part 1125.
1189. gbinv1126.seq - Invertebrate sequence entries, part 1126.
1190. gbinv1127.seq - Invertebrate sequence entries, part 1127.
1191. gbinv1128.seq - Invertebrate sequence entries, part 1128.
1192. gbinv1129.seq - Invertebrate sequence entries, part 1129.
1193. gbinv113.seq - Invertebrate sequence entries, part 113.
1194. gbinv1130.seq - Invertebrate sequence entries, part 1130.
1195. gbinv1131.seq - Invertebrate sequence entries, part 1131.
1196. gbinv1132.seq - Invertebrate sequence entries, part 1132.
1197. gbinv1133.seq - Invertebrate sequence entries, part 1133.
1198. gbinv1134.seq - Invertebrate sequence entries, part 1134.
1199. gbinv1135.seq - Invertebrate sequence entries, part 1135.
1200. gbinv1136.seq - Invertebrate sequence entries, part 1136.
1201. gbinv1137.seq - Invertebrate sequence entries, part 1137.
1202. gbinv1138.seq - Invertebrate sequence entries, part 1138.
1203. gbinv114.seq - Invertebrate sequence entries, part 114.
1204. gbinv115.seq - Invertebrate sequence entries, part 115.
1205. gbinv116.seq - Invertebrate sequence entries, part 116.
1206. gbinv117.seq - Invertebrate sequence entries, part 117.
1207. gbinv118.seq - Invertebrate sequence entries, part 118.
1208. gbinv119.seq - Invertebrate sequence entries, part 119.
1209. gbinv12.seq - Invertebrate sequence entries, part 12.
1210. gbinv120.seq - Invertebrate sequence entries, part 120.
1211. gbinv121.seq - Invertebrate sequence entries, part 121.
1212. gbinv122.seq - Invertebrate sequence entries, part 122.
1213. gbinv123.seq - Invertebrate sequence entries, part 123.
1214. gbinv124.seq - Invertebrate sequence entries, part 124.
1215. gbinv125.seq - Invertebrate sequence entries, part 125.
1216. gbinv126.seq - Invertebrate sequence entries, part 126.
1217. gbinv127.seq - Invertebrate sequence entries, part 127.
1218. gbinv128.seq - Invertebrate sequence entries, part 128.
1219. gbinv129.seq - Invertebrate sequence entries, part 129.
1220. gbinv13.seq - Invertebrate sequence entries, part 13.
1221. gbinv130.seq - Invertebrate sequence entries, part 130.
1222. gbinv131.seq - Invertebrate sequence entries, part 131.
1223. gbinv132.seq - Invertebrate sequence entries, part 132.
1224. gbinv133.seq - Invertebrate sequence entries, part 133.
1225. gbinv134.seq - Invertebrate sequence entries, part 134.
1226. gbinv135.seq - Invertebrate sequence entries, part 135.
1227. gbinv136.seq - Invertebrate sequence entries, part 136.
1228. gbinv137.seq - Invertebrate sequence entries, part 137.
1229. gbinv138.seq - Invertebrate sequence entries, part 138.
1230. gbinv139.seq - Invertebrate sequence entries, part 139.
1231. gbinv14.seq - Invertebrate sequence entries, part 14.
1232. gbinv140.seq - Invertebrate sequence entries, part 140.
1233. gbinv141.seq - Invertebrate sequence entries, part 141.
1234. gbinv142.seq - Invertebrate sequence entries, part 142.
1235. gbinv143.seq - Invertebrate sequence entries, part 143.
1236. gbinv144.seq - Invertebrate sequence entries, part 144.
1237. gbinv145.seq - Invertebrate sequence entries, part 145.
1238. gbinv146.seq - Invertebrate sequence entries, part 146.
1239. gbinv147.seq - Invertebrate sequence entries, part 147.
1240. gbinv148.seq - Invertebrate sequence entries, part 148.
1241. gbinv149.seq - Invertebrate sequence entries, part 149.
1242. gbinv15.seq - Invertebrate sequence entries, part 15.
1243. gbinv150.seq - Invertebrate sequence entries, part 150.
1244. gbinv151.seq - Invertebrate sequence entries, part 151.
1245. gbinv152.seq - Invertebrate sequence entries, part 152.
1246. gbinv153.seq - Invertebrate sequence entries, part 153.
1247. gbinv154.seq - Invertebrate sequence entries, part 154.
1248. gbinv155.seq - Invertebrate sequence entries, part 155.
1249. gbinv156.seq - Invertebrate sequence entries, part 156.
1250. gbinv157.seq - Invertebrate sequence entries, part 157.
1251. gbinv158.seq - Invertebrate sequence entries, part 158.
1252. gbinv159.seq - Invertebrate sequence entries, part 159.
1253. gbinv16.seq - Invertebrate sequence entries, part 16.
1254. gbinv160.seq - Invertebrate sequence entries, part 160.
1255. gbinv161.seq - Invertebrate sequence entries, part 161.
1256. gbinv162.seq - Invertebrate sequence entries, part 162.
1257. gbinv163.seq - Invertebrate sequence entries, part 163.
1258. gbinv164.seq - Invertebrate sequence entries, part 164.
1259. gbinv165.seq - Invertebrate sequence entries, part 165.
1260. gbinv166.seq - Invertebrate sequence entries, part 166.
1261. gbinv167.seq - Invertebrate sequence entries, part 167.
1262. gbinv168.seq - Invertebrate sequence entries, part 168.
1263. gbinv169.seq - Invertebrate sequence entries, part 169.
1264. gbinv17.seq - Invertebrate sequence entries, part 17.
1265. gbinv170.seq - Invertebrate sequence entries, part 170.
1266. gbinv171.seq - Invertebrate sequence entries, part 171.
1267. gbinv172.seq - Invertebrate sequence entries, part 172.
1268. gbinv173.seq - Invertebrate sequence entries, part 173.
1269. gbinv174.seq - Invertebrate sequence entries, part 174.
1270. gbinv175.seq - Invertebrate sequence entries, part 175.
1271. gbinv176.seq - Invertebrate sequence entries, part 176.
1272. gbinv177.seq - Invertebrate sequence entries, part 177.
1273. gbinv178.seq - Invertebrate sequence entries, part 178.
1274. gbinv179.seq - Invertebrate sequence entries, part 179.
1275. gbinv18.seq - Invertebrate sequence entries, part 18.
1276. gbinv180.seq - Invertebrate sequence entries, part 180.
1277. gbinv181.seq - Invertebrate sequence entries, part 181.
1278. gbinv182.seq - Invertebrate sequence entries, part 182.
1279. gbinv183.seq - Invertebrate sequence entries, part 183.
1280. gbinv184.seq - Invertebrate sequence entries, part 184.
1281. gbinv185.seq - Invertebrate sequence entries, part 185.
1282. gbinv186.seq - Invertebrate sequence entries, part 186.
1283. gbinv187.seq - Invertebrate sequence entries, part 187.
1284. gbinv188.seq - Invertebrate sequence entries, part 188.
1285. gbinv189.seq - Invertebrate sequence entries, part 189.
1286. gbinv19.seq - Invertebrate sequence entries, part 19.
1287. gbinv190.seq - Invertebrate sequence entries, part 190.
1288. gbinv191.seq - Invertebrate sequence entries, part 191.
1289. gbinv192.seq - Invertebrate sequence entries, part 192.
1290. gbinv193.seq - Invertebrate sequence entries, part 193.
1291. gbinv194.seq - Invertebrate sequence entries, part 194.
1292. gbinv195.seq - Invertebrate sequence entries, part 195.
1293. gbinv196.seq - Invertebrate sequence entries, part 196.
1294. gbinv197.seq - Invertebrate sequence entries, part 197.
1295. gbinv198.seq - Invertebrate sequence entries, part 198.
1296. gbinv199.seq - Invertebrate sequence entries, part 199.
1297. gbinv2.seq - Invertebrate sequence entries, part 2.
1298. gbinv20.seq - Invertebrate sequence entries, part 20.
1299. gbinv200.seq - Invertebrate sequence entries, part 200.
1300. gbinv201.seq - Invertebrate sequence entries, part 201.
1301. gbinv202.seq - Invertebrate sequence entries, part 202.
1302. gbinv203.seq - Invertebrate sequence entries, part 203.
1303. gbinv204.seq - Invertebrate sequence entries, part 204.
1304. gbinv205.seq - Invertebrate sequence entries, part 205.
1305. gbinv206.seq - Invertebrate sequence entries, part 206.
1306. gbinv207.seq - Invertebrate sequence entries, part 207.
1307. gbinv208.seq - Invertebrate sequence entries, part 208.
1308. gbinv209.seq - Invertebrate sequence entries, part 209.
1309. gbinv21.seq - Invertebrate sequence entries, part 21.
1310. gbinv210.seq - Invertebrate sequence entries, part 210.
1311. gbinv211.seq - Invertebrate sequence entries, part 211.
1312. gbinv212.seq - Invertebrate sequence entries, part 212.
1313. gbinv213.seq - Invertebrate sequence entries, part 213.
1314. gbinv214.seq - Invertebrate sequence entries, part 214.
1315. gbinv215.seq - Invertebrate sequence entries, part 215.
1316. gbinv216.seq - Invertebrate sequence entries, part 216.
1317. gbinv217.seq - Invertebrate sequence entries, part 217.
1318. gbinv218.seq - Invertebrate sequence entries, part 218.
1319. gbinv219.seq - Invertebrate sequence entries, part 219.
1320. gbinv22.seq - Invertebrate sequence entries, part 22.
1321. gbinv220.seq - Invertebrate sequence entries, part 220.
1322. gbinv221.seq - Invertebrate sequence entries, part 221.
1323. gbinv222.seq - Invertebrate sequence entries, part 222.
1324. gbinv223.seq - Invertebrate sequence entries, part 223.
1325. gbinv224.seq - Invertebrate sequence entries, part 224.
1326. gbinv225.seq - Invertebrate sequence entries, part 225.
1327. gbinv226.seq - Invertebrate sequence entries, part 226.
1328. gbinv227.seq - Invertebrate sequence entries, part 227.
1329. gbinv228.seq - Invertebrate sequence entries, part 228.
1330. gbinv229.seq - Invertebrate sequence entries, part 229.
1331. gbinv23.seq - Invertebrate sequence entries, part 23.
1332. gbinv230.seq - Invertebrate sequence entries, part 230.
1333. gbinv231.seq - Invertebrate sequence entries, part 231.
1334. gbinv232.seq - Invertebrate sequence entries, part 232.
1335. gbinv233.seq - Invertebrate sequence entries, part 233.
1336. gbinv234.seq - Invertebrate sequence entries, part 234.
1337. gbinv235.seq - Invertebrate sequence entries, part 235.
1338. gbinv236.seq - Invertebrate sequence entries, part 236.
1339. gbinv237.seq - Invertebrate sequence entries, part 237.
1340. gbinv238.seq - Invertebrate sequence entries, part 238.
1341. gbinv239.seq - Invertebrate sequence entries, part 239.
1342. gbinv24.seq - Invertebrate sequence entries, part 24.
1343. gbinv240.seq - Invertebrate sequence entries, part 240.
1344. gbinv241.seq - Invertebrate sequence entries, part 241.
1345. gbinv242.seq - Invertebrate sequence entries, part 242.
1346. gbinv243.seq - Invertebrate sequence entries, part 243.
1347. gbinv244.seq - Invertebrate sequence entries, part 244.
1348. gbinv245.seq - Invertebrate sequence entries, part 245.
1349. gbinv246.seq - Invertebrate sequence entries, part 246.
1350. gbinv247.seq - Invertebrate sequence entries, part 247.
1351. gbinv248.seq - Invertebrate sequence entries, part 248.
1352. gbinv249.seq - Invertebrate sequence entries, part 249.
1353. gbinv25.seq - Invertebrate sequence entries, part 25.
1354. gbinv250.seq - Invertebrate sequence entries, part 250.
1355. gbinv251.seq - Invertebrate sequence entries, part 251.
1356. gbinv252.seq - Invertebrate sequence entries, part 252.
1357. gbinv253.seq - Invertebrate sequence entries, part 253.
1358. gbinv254.seq - Invertebrate sequence entries, part 254.
1359. gbinv255.seq - Invertebrate sequence entries, part 255.
1360. gbinv256.seq - Invertebrate sequence entries, part 256.
1361. gbinv257.seq - Invertebrate sequence entries, part 257.
1362. gbinv258.seq - Invertebrate sequence entries, part 258.
1363. gbinv259.seq - Invertebrate sequence entries, part 259.
1364. gbinv26.seq - Invertebrate sequence entries, part 26.
1365. gbinv260.seq - Invertebrate sequence entries, part 260.
1366. gbinv261.seq - Invertebrate sequence entries, part 261.
1367. gbinv262.seq - Invertebrate sequence entries, part 262.
1368. gbinv263.seq - Invertebrate sequence entries, part 263.
1369. gbinv264.seq - Invertebrate sequence entries, part 264.
1370. gbinv265.seq - Invertebrate sequence entries, part 265.
1371. gbinv266.seq - Invertebrate sequence entries, part 266.
1372. gbinv267.seq - Invertebrate sequence entries, part 267.
1373. gbinv268.seq - Invertebrate sequence entries, part 268.
1374. gbinv269.seq - Invertebrate sequence entries, part 269.
1375. gbinv27.seq - Invertebrate sequence entries, part 27.
1376. gbinv270.seq - Invertebrate sequence entries, part 270.
1377. gbinv271.seq - Invertebrate sequence entries, part 271.
1378. gbinv272.seq - Invertebrate sequence entries, part 272.
1379. gbinv273.seq - Invertebrate sequence entries, part 273.
1380. gbinv274.seq - Invertebrate sequence entries, part 274.
1381. gbinv275.seq - Invertebrate sequence entries, part 275.
1382. gbinv276.seq - Invertebrate sequence entries, part 276.
1383. gbinv277.seq - Invertebrate sequence entries, part 277.
1384. gbinv278.seq - Invertebrate sequence entries, part 278.
1385. gbinv279.seq - Invertebrate sequence entries, part 279.
1386. gbinv28.seq - Invertebrate sequence entries, part 28.
1387. gbinv280.seq - Invertebrate sequence entries, part 280.
1388. gbinv281.seq - Invertebrate sequence entries, part 281.
1389. gbinv282.seq - Invertebrate sequence entries, part 282.
1390. gbinv283.seq - Invertebrate sequence entries, part 283.
1391. gbinv284.seq - Invertebrate sequence entries, part 284.
1392. gbinv285.seq - Invertebrate sequence entries, part 285.
1393. gbinv286.seq - Invertebrate sequence entries, part 286.
1394. gbinv287.seq - Invertebrate sequence entries, part 287.
1395. gbinv288.seq - Invertebrate sequence entries, part 288.
1396. gbinv289.seq - Invertebrate sequence entries, part 289.
1397. gbinv29.seq - Invertebrate sequence entries, part 29.
1398. gbinv290.seq - Invertebrate sequence entries, part 290.
1399. gbinv291.seq - Invertebrate sequence entries, part 291.
1400. gbinv292.seq - Invertebrate sequence entries, part 292.
1401. gbinv293.seq - Invertebrate sequence entries, part 293.
1402. gbinv294.seq - Invertebrate sequence entries, part 294.
1403. gbinv295.seq - Invertebrate sequence entries, part 295.
1404. gbinv296.seq - Invertebrate sequence entries, part 296.
1405. gbinv297.seq - Invertebrate sequence entries, part 297.
1406. gbinv298.seq - Invertebrate sequence entries, part 298.
1407. gbinv299.seq - Invertebrate sequence entries, part 299.
1408. gbinv3.seq - Invertebrate sequence entries, part 3.
1409. gbinv30.seq - Invertebrate sequence entries, part 30.
1410. gbinv300.seq - Invertebrate sequence entries, part 300.
1411. gbinv301.seq - Invertebrate sequence entries, part 301.
1412. gbinv302.seq - Invertebrate sequence entries, part 302.
1413. gbinv303.seq - Invertebrate sequence entries, part 303.
1414. gbinv304.seq - Invertebrate sequence entries, part 304.
1415. gbinv305.seq - Invertebrate sequence entries, part 305.
1416. gbinv306.seq - Invertebrate sequence entries, part 306.
1417. gbinv307.seq - Invertebrate sequence entries, part 307.
1418. gbinv308.seq - Invertebrate sequence entries, part 308.
1419. gbinv309.seq - Invertebrate sequence entries, part 309.
1420. gbinv31.seq - Invertebrate sequence entries, part 31.
1421. gbinv310.seq - Invertebrate sequence entries, part 310.
1422. gbinv311.seq - Invertebrate sequence entries, part 311.
1423. gbinv312.seq - Invertebrate sequence entries, part 312.
1424. gbinv313.seq - Invertebrate sequence entries, part 313.
1425. gbinv314.seq - Invertebrate sequence entries, part 314.
1426. gbinv315.seq - Invertebrate sequence entries, part 315.
1427. gbinv316.seq - Invertebrate sequence entries, part 316.
1428. gbinv317.seq - Invertebrate sequence entries, part 317.
1429. gbinv318.seq - Invertebrate sequence entries, part 318.
1430. gbinv319.seq - Invertebrate sequence entries, part 319.
1431. gbinv32.seq - Invertebrate sequence entries, part 32.
1432. gbinv320.seq - Invertebrate sequence entries, part 320.
1433. gbinv321.seq - Invertebrate sequence entries, part 321.
1434. gbinv322.seq - Invertebrate sequence entries, part 322.
1435. gbinv323.seq - Invertebrate sequence entries, part 323.
1436. gbinv324.seq - Invertebrate sequence entries, part 324.
1437. gbinv325.seq - Invertebrate sequence entries, part 325.
1438. gbinv326.seq - Invertebrate sequence entries, part 326.
1439. gbinv327.seq - Invertebrate sequence entries, part 327.
1440. gbinv328.seq - Invertebrate sequence entries, part 328.
1441. gbinv329.seq - Invertebrate sequence entries, part 329.
1442. gbinv33.seq - Invertebrate sequence entries, part 33.
1443. gbinv330.seq - Invertebrate sequence entries, part 330.
1444. gbinv331.seq - Invertebrate sequence entries, part 331.
1445. gbinv332.seq - Invertebrate sequence entries, part 332.
1446. gbinv333.seq - Invertebrate sequence entries, part 333.
1447. gbinv334.seq - Invertebrate sequence entries, part 334.
1448. gbinv335.seq - Invertebrate sequence entries, part 335.
1449. gbinv336.seq - Invertebrate sequence entries, part 336.
1450. gbinv337.seq - Invertebrate sequence entries, part 337.
1451. gbinv338.seq - Invertebrate sequence entries, part 338.
1452. gbinv339.seq - Invertebrate sequence entries, part 339.
1453. gbinv34.seq - Invertebrate sequence entries, part 34.
1454. gbinv340.seq - Invertebrate sequence entries, part 340.
1455. gbinv341.seq - Invertebrate sequence entries, part 341.
1456. gbinv342.seq - Invertebrate sequence entries, part 342.
1457. gbinv343.seq - Invertebrate sequence entries, part 343.
1458. gbinv344.seq - Invertebrate sequence entries, part 344.
1459. gbinv345.seq - Invertebrate sequence entries, part 345.
1460. gbinv346.seq - Invertebrate sequence entries, part 346.
1461. gbinv347.seq - Invertebrate sequence entries, part 347.
1462. gbinv348.seq - Invertebrate sequence entries, part 348.
1463. gbinv349.seq - Invertebrate sequence entries, part 349.
1464. gbinv35.seq - Invertebrate sequence entries, part 35.
1465. gbinv350.seq - Invertebrate sequence entries, part 350.
1466. gbinv351.seq - Invertebrate sequence entries, part 351.
1467. gbinv352.seq - Invertebrate sequence entries, part 352.
1468. gbinv353.seq - Invertebrate sequence entries, part 353.
1469. gbinv354.seq - Invertebrate sequence entries, part 354.
1470. gbinv355.seq - Invertebrate sequence entries, part 355.
1471. gbinv356.seq - Invertebrate sequence entries, part 356.
1472. gbinv357.seq - Invertebrate sequence entries, part 357.
1473. gbinv358.seq - Invertebrate sequence entries, part 358.
1474. gbinv359.seq - Invertebrate sequence entries, part 359.
1475. gbinv36.seq - Invertebrate sequence entries, part 36.
1476. gbinv360.seq - Invertebrate sequence entries, part 360.
1477. gbinv361.seq - Invertebrate sequence entries, part 361.
1478. gbinv362.seq - Invertebrate sequence entries, part 362.
1479. gbinv363.seq - Invertebrate sequence entries, part 363.
1480. gbinv364.seq - Invertebrate sequence entries, part 364.
1481. gbinv365.seq - Invertebrate sequence entries, part 365.
1482. gbinv366.seq - Invertebrate sequence entries, part 366.
1483. gbinv367.seq - Invertebrate sequence entries, part 367.
1484. gbinv368.seq - Invertebrate sequence entries, part 368.
1485. gbinv369.seq - Invertebrate sequence entries, part 369.
1486. gbinv37.seq - Invertebrate sequence entries, part 37.
1487. gbinv370.seq - Invertebrate sequence entries, part 370.
1488. gbinv371.seq - Invertebrate sequence entries, part 371.
1489. gbinv372.seq - Invertebrate sequence entries, part 372.
1490. gbinv373.seq - Invertebrate sequence entries, part 373.
1491. gbinv374.seq - Invertebrate sequence entries, part 374.
1492. gbinv375.seq - Invertebrate sequence entries, part 375.
1493. gbinv376.seq - Invertebrate sequence entries, part 376.
1494. gbinv377.seq - Invertebrate sequence entries, part 377.
1495. gbinv378.seq - Invertebrate sequence entries, part 378.
1496. gbinv379.seq - Invertebrate sequence entries, part 379.
1497. gbinv38.seq - Invertebrate sequence entries, part 38.
1498. gbinv380.seq - Invertebrate sequence entries, part 380.
1499. gbinv381.seq - Invertebrate sequence entries, part 381.
1500. gbinv382.seq - Invertebrate sequence entries, part 382.
1501. gbinv383.seq - Invertebrate sequence entries, part 383.
1502. gbinv384.seq - Invertebrate sequence entries, part 384.
1503. gbinv385.seq - Invertebrate sequence entries, part 385.
1504. gbinv386.seq - Invertebrate sequence entries, part 386.
1505. gbinv387.seq - Invertebrate sequence entries, part 387.
1506. gbinv388.seq - Invertebrate sequence entries, part 388.
1507. gbinv389.seq - Invertebrate sequence entries, part 389.
1508. gbinv39.seq - Invertebrate sequence entries, part 39.
1509. gbinv390.seq - Invertebrate sequence entries, part 390.
1510. gbinv391.seq - Invertebrate sequence entries, part 391.
1511. gbinv392.seq - Invertebrate sequence entries, part 392.
1512. gbinv393.seq - Invertebrate sequence entries, part 393.
1513. gbinv394.seq - Invertebrate sequence entries, part 394.
1514. gbinv395.seq - Invertebrate sequence entries, part 395.
1515. gbinv396.seq - Invertebrate sequence entries, part 396.
1516. gbinv397.seq - Invertebrate sequence entries, part 397.
1517. gbinv398.seq - Invertebrate sequence entries, part 398.
1518. gbinv399.seq - Invertebrate sequence entries, part 399.
1519. gbinv4.seq - Invertebrate sequence entries, part 4.
1520. gbinv40.seq - Invertebrate sequence entries, part 40.
1521. gbinv400.seq - Invertebrate sequence entries, part 400.
1522. gbinv401.seq - Invertebrate sequence entries, part 401.
1523. gbinv402.seq - Invertebrate sequence entries, part 402.
1524. gbinv403.seq - Invertebrate sequence entries, part 403.
1525. gbinv404.seq - Invertebrate sequence entries, part 404.
1526. gbinv405.seq - Invertebrate sequence entries, part 405.
1527. gbinv406.seq - Invertebrate sequence entries, part 406.
1528. gbinv407.seq - Invertebrate sequence entries, part 407.
1529. gbinv408.seq - Invertebrate sequence entries, part 408.
1530. gbinv409.seq - Invertebrate sequence entries, part 409.
1531. gbinv41.seq - Invertebrate sequence entries, part 41.
1532. gbinv410.seq - Invertebrate sequence entries, part 410.
1533. gbinv411.seq - Invertebrate sequence entries, part 411.
1534. gbinv412.seq - Invertebrate sequence entries, part 412.
1535. gbinv413.seq - Invertebrate sequence entries, part 413.
1536. gbinv414.seq - Invertebrate sequence entries, part 414.
1537. gbinv415.seq - Invertebrate sequence entries, part 415.
1538. gbinv416.seq - Invertebrate sequence entries, part 416.
1539. gbinv417.seq - Invertebrate sequence entries, part 417.
1540. gbinv418.seq - Invertebrate sequence entries, part 418.
1541. gbinv419.seq - Invertebrate sequence entries, part 419.
1542. gbinv42.seq - Invertebrate sequence entries, part 42.
1543. gbinv420.seq - Invertebrate sequence entries, part 420.
1544. gbinv421.seq - Invertebrate sequence entries, part 421.
1545. gbinv422.seq - Invertebrate sequence entries, part 422.
1546. gbinv423.seq - Invertebrate sequence entries, part 423.
1547. gbinv424.seq - Invertebrate sequence entries, part 424.
1548. gbinv425.seq - Invertebrate sequence entries, part 425.
1549. gbinv426.seq - Invertebrate sequence entries, part 426.
1550. gbinv427.seq - Invertebrate sequence entries, part 427.
1551. gbinv428.seq - Invertebrate sequence entries, part 428.
1552. gbinv429.seq - Invertebrate sequence entries, part 429.
1553. gbinv43.seq - Invertebrate sequence entries, part 43.
1554. gbinv430.seq - Invertebrate sequence entries, part 430.
1555. gbinv431.seq - Invertebrate sequence entries, part 431.
1556. gbinv432.seq - Invertebrate sequence entries, part 432.
1557. gbinv433.seq - Invertebrate sequence entries, part 433.
1558. gbinv434.seq - Invertebrate sequence entries, part 434.
1559. gbinv435.seq - Invertebrate sequence entries, part 435.
1560. gbinv436.seq - Invertebrate sequence entries, part 436.
1561. gbinv437.seq - Invertebrate sequence entries, part 437.
1562. gbinv438.seq - Invertebrate sequence entries, part 438.
1563. gbinv439.seq - Invertebrate sequence entries, part 439.
1564. gbinv44.seq - Invertebrate sequence entries, part 44.
1565. gbinv440.seq - Invertebrate sequence entries, part 440.
1566. gbinv441.seq - Invertebrate sequence entries, part 441.
1567. gbinv442.seq - Invertebrate sequence entries, part 442.
1568. gbinv443.seq - Invertebrate sequence entries, part 443.
1569. gbinv444.seq - Invertebrate sequence entries, part 444.
1570. gbinv445.seq - Invertebrate sequence entries, part 445.
1571. gbinv446.seq - Invertebrate sequence entries, part 446.
1572. gbinv447.seq - Invertebrate sequence entries, part 447.
1573. gbinv448.seq - Invertebrate sequence entries, part 448.
1574. gbinv449.seq - Invertebrate sequence entries, part 449.
1575. gbinv45.seq - Invertebrate sequence entries, part 45.
1576. gbinv450.seq - Invertebrate sequence entries, part 450.
1577. gbinv451.seq - Invertebrate sequence entries, part 451.
1578. gbinv452.seq - Invertebrate sequence entries, part 452.
1579. gbinv453.seq - Invertebrate sequence entries, part 453.
1580. gbinv454.seq - Invertebrate sequence entries, part 454.
1581. gbinv455.seq - Invertebrate sequence entries, part 455.
1582. gbinv456.seq - Invertebrate sequence entries, part 456.
1583. gbinv457.seq - Invertebrate sequence entries, part 457.
1584. gbinv458.seq - Invertebrate sequence entries, part 458.
1585. gbinv459.seq - Invertebrate sequence entries, part 459.
1586. gbinv46.seq - Invertebrate sequence entries, part 46.
1587. gbinv460.seq - Invertebrate sequence entries, part 460.
1588. gbinv461.seq - Invertebrate sequence entries, part 461.
1589. gbinv462.seq - Invertebrate sequence entries, part 462.
1590. gbinv463.seq - Invertebrate sequence entries, part 463.
1591. gbinv464.seq - Invertebrate sequence entries, part 464.
1592. gbinv465.seq - Invertebrate sequence entries, part 465.
1593. gbinv466.seq - Invertebrate sequence entries, part 466.
1594. gbinv467.seq - Invertebrate sequence entries, part 467.
1595. gbinv468.seq - Invertebrate sequence entries, part 468.
1596. gbinv469.seq - Invertebrate sequence entries, part 469.
1597. gbinv47.seq - Invertebrate sequence entries, part 47.
1598. gbinv470.seq - Invertebrate sequence entries, part 470.
1599. gbinv471.seq - Invertebrate sequence entries, part 471.
1600. gbinv472.seq - Invertebrate sequence entries, part 472.
1601. gbinv473.seq - Invertebrate sequence entries, part 473.
1602. gbinv474.seq - Invertebrate sequence entries, part 474.
1603. gbinv475.seq - Invertebrate sequence entries, part 475.
1604. gbinv476.seq - Invertebrate sequence entries, part 476.
1605. gbinv477.seq - Invertebrate sequence entries, part 477.
1606. gbinv478.seq - Invertebrate sequence entries, part 478.
1607. gbinv479.seq - Invertebrate sequence entries, part 479.
1608. gbinv48.seq - Invertebrate sequence entries, part 48.
1609. gbinv480.seq - Invertebrate sequence entries, part 480.
1610. gbinv481.seq - Invertebrate sequence entries, part 481.
1611. gbinv482.seq - Invertebrate sequence entries, part 482.
1612. gbinv483.seq - Invertebrate sequence entries, part 483.
1613. gbinv484.seq - Invertebrate sequence entries, part 484.
1614. gbinv485.seq - Invertebrate sequence entries, part 485.
1615. gbinv486.seq - Invertebrate sequence entries, part 486.
1616. gbinv487.seq - Invertebrate sequence entries, part 487.
1617. gbinv488.seq - Invertebrate sequence entries, part 488.
1618. gbinv489.seq - Invertebrate sequence entries, part 489.
1619. gbinv49.seq - Invertebrate sequence entries, part 49.
1620. gbinv490.seq - Invertebrate sequence entries, part 490.
1621. gbinv491.seq - Invertebrate sequence entries, part 491.
1622. gbinv492.seq - Invertebrate sequence entries, part 492.
1623. gbinv493.seq - Invertebrate sequence entries, part 493.
1624. gbinv494.seq - Invertebrate sequence entries, part 494.
1625. gbinv495.seq - Invertebrate sequence entries, part 495.
1626. gbinv496.seq - Invertebrate sequence entries, part 496.
1627. gbinv497.seq - Invertebrate sequence entries, part 497.
1628. gbinv498.seq - Invertebrate sequence entries, part 498.
1629. gbinv499.seq - Invertebrate sequence entries, part 499.
1630. gbinv5.seq - Invertebrate sequence entries, part 5.
1631. gbinv50.seq - Invertebrate sequence entries, part 50.
1632. gbinv500.seq - Invertebrate sequence entries, part 500.
1633. gbinv501.seq - Invertebrate sequence entries, part 501.
1634. gbinv502.seq - Invertebrate sequence entries, part 502.
1635. gbinv503.seq - Invertebrate sequence entries, part 503.
1636. gbinv504.seq - Invertebrate sequence entries, part 504.
1637. gbinv505.seq - Invertebrate sequence entries, part 505.
1638. gbinv506.seq - Invertebrate sequence entries, part 506.
1639. gbinv507.seq - Invertebrate sequence entries, part 507.
1640. gbinv508.seq - Invertebrate sequence entries, part 508.
1641. gbinv509.seq - Invertebrate sequence entries, part 509.
1642. gbinv51.seq - Invertebrate sequence entries, part 51.
1643. gbinv510.seq - Invertebrate sequence entries, part 510.
1644. gbinv511.seq - Invertebrate sequence entries, part 511.
1645. gbinv512.seq - Invertebrate sequence entries, part 512.
1646. gbinv513.seq - Invertebrate sequence entries, part 513.
1647. gbinv514.seq - Invertebrate sequence entries, part 514.
1648. gbinv515.seq - Invertebrate sequence entries, part 515.
1649. gbinv516.seq - Invertebrate sequence entries, part 516.
1650. gbinv517.seq - Invertebrate sequence entries, part 517.
1651. gbinv518.seq - Invertebrate sequence entries, part 518.
1652. gbinv519.seq - Invertebrate sequence entries, part 519.
1653. gbinv52.seq - Invertebrate sequence entries, part 52.
1654. gbinv520.seq - Invertebrate sequence entries, part 520.
1655. gbinv521.seq - Invertebrate sequence entries, part 521.
1656. gbinv522.seq - Invertebrate sequence entries, part 522.
1657. gbinv523.seq - Invertebrate sequence entries, part 523.
1658. gbinv524.seq - Invertebrate sequence entries, part 524.
1659. gbinv525.seq - Invertebrate sequence entries, part 525.
1660. gbinv526.seq - Invertebrate sequence entries, part 526.
1661. gbinv527.seq - Invertebrate sequence entries, part 527.
1662. gbinv528.seq - Invertebrate sequence entries, part 528.
1663. gbinv529.seq - Invertebrate sequence entries, part 529.
1664. gbinv53.seq - Invertebrate sequence entries, part 53.
1665. gbinv530.seq - Invertebrate sequence entries, part 530.
1666. gbinv531.seq - Invertebrate sequence entries, part 531.
1667. gbinv532.seq - Invertebrate sequence entries, part 532.
1668. gbinv533.seq - Invertebrate sequence entries, part 533.
1669. gbinv534.seq - Invertebrate sequence entries, part 534.
1670. gbinv535.seq - Invertebrate sequence entries, part 535.
1671. gbinv536.seq - Invertebrate sequence entries, part 536.
1672. gbinv537.seq - Invertebrate sequence entries, part 537.
1673. gbinv538.seq - Invertebrate sequence entries, part 538.
1674. gbinv539.seq - Invertebrate sequence entries, part 539.
1675. gbinv54.seq - Invertebrate sequence entries, part 54.
1676. gbinv540.seq - Invertebrate sequence entries, part 540.
1677. gbinv541.seq - Invertebrate sequence entries, part 541.
1678. gbinv542.seq - Invertebrate sequence entries, part 542.
1679. gbinv543.seq - Invertebrate sequence entries, part 543.
1680. gbinv544.seq - Invertebrate sequence entries, part 544.
1681. gbinv545.seq - Invertebrate sequence entries, part 545.
1682. gbinv546.seq - Invertebrate sequence entries, part 546.
1683. gbinv547.seq - Invertebrate sequence entries, part 547.
1684. gbinv548.seq - Invertebrate sequence entries, part 548.
1685. gbinv549.seq - Invertebrate sequence entries, part 549.
1686. gbinv55.seq - Invertebrate sequence entries, part 55.
1687. gbinv550.seq - Invertebrate sequence entries, part 550.
1688. gbinv551.seq - Invertebrate sequence entries, part 551.
1689. gbinv552.seq - Invertebrate sequence entries, part 552.
1690. gbinv553.seq - Invertebrate sequence entries, part 553.
1691. gbinv554.seq - Invertebrate sequence entries, part 554.
1692. gbinv555.seq - Invertebrate sequence entries, part 555.
1693. gbinv556.seq - Invertebrate sequence entries, part 556.
1694. gbinv557.seq - Invertebrate sequence entries, part 557.
1695. gbinv558.seq - Invertebrate sequence entries, part 558.
1696. gbinv559.seq - Invertebrate sequence entries, part 559.
1697. gbinv56.seq - Invertebrate sequence entries, part 56.
1698. gbinv560.seq - Invertebrate sequence entries, part 560.
1699. gbinv561.seq - Invertebrate sequence entries, part 561.
1700. gbinv562.seq - Invertebrate sequence entries, part 562.
1701. gbinv563.seq - Invertebrate sequence entries, part 563.
1702. gbinv564.seq - Invertebrate sequence entries, part 564.
1703. gbinv565.seq - Invertebrate sequence entries, part 565.
1704. gbinv566.seq - Invertebrate sequence entries, part 566.
1705. gbinv567.seq - Invertebrate sequence entries, part 567.
1706. gbinv568.seq - Invertebrate sequence entries, part 568.
1707. gbinv569.seq - Invertebrate sequence entries, part 569.
1708. gbinv57.seq - Invertebrate sequence entries, part 57.
1709. gbinv570.seq - Invertebrate sequence entries, part 570.
1710. gbinv571.seq - Invertebrate sequence entries, part 571.
1711. gbinv572.seq - Invertebrate sequence entries, part 572.
1712. gbinv573.seq - Invertebrate sequence entries, part 573.
1713. gbinv574.seq - Invertebrate sequence entries, part 574.
1714. gbinv575.seq - Invertebrate sequence entries, part 575.
1715. gbinv576.seq - Invertebrate sequence entries, part 576.
1716. gbinv577.seq - Invertebrate sequence entries, part 577.
1717. gbinv578.seq - Invertebrate sequence entries, part 578.
1718. gbinv579.seq - Invertebrate sequence entries, part 579.
1719. gbinv58.seq - Invertebrate sequence entries, part 58.
1720. gbinv580.seq - Invertebrate sequence entries, part 580.
1721. gbinv581.seq - Invertebrate sequence entries, part 581.
1722. gbinv582.seq - Invertebrate sequence entries, part 582.
1723. gbinv583.seq - Invertebrate sequence entries, part 583.
1724. gbinv584.seq - Invertebrate sequence entries, part 584.
1725. gbinv585.seq - Invertebrate sequence entries, part 585.
1726. gbinv586.seq - Invertebrate sequence entries, part 586.
1727. gbinv587.seq - Invertebrate sequence entries, part 587.
1728. gbinv588.seq - Invertebrate sequence entries, part 588.
1729. gbinv589.seq - Invertebrate sequence entries, part 589.
1730. gbinv59.seq - Invertebrate sequence entries, part 59.
1731. gbinv590.seq - Invertebrate sequence entries, part 590.
1732. gbinv591.seq - Invertebrate sequence entries, part 591.
1733. gbinv592.seq - Invertebrate sequence entries, part 592.
1734. gbinv593.seq - Invertebrate sequence entries, part 593.
1735. gbinv594.seq - Invertebrate sequence entries, part 594.
1736. gbinv595.seq - Invertebrate sequence entries, part 595.
1737. gbinv596.seq - Invertebrate sequence entries, part 596.
1738. gbinv597.seq - Invertebrate sequence entries, part 597.
1739. gbinv598.seq - Invertebrate sequence entries, part 598.
1740. gbinv599.seq - Invertebrate sequence entries, part 599.
1741. gbinv6.seq - Invertebrate sequence entries, part 6.
1742. gbinv60.seq - Invertebrate sequence entries, part 60.
1743. gbinv600.seq - Invertebrate sequence entries, part 600.
1744. gbinv601.seq - Invertebrate sequence entries, part 601.
1745. gbinv602.seq - Invertebrate sequence entries, part 602.
1746. gbinv603.seq - Invertebrate sequence entries, part 603.
1747. gbinv604.seq - Invertebrate sequence entries, part 604.
1748. gbinv605.seq - Invertebrate sequence entries, part 605.
1749. gbinv606.seq - Invertebrate sequence entries, part 606.
1750. gbinv607.seq - Invertebrate sequence entries, part 607.
1751. gbinv608.seq - Invertebrate sequence entries, part 608.
1752. gbinv609.seq - Invertebrate sequence entries, part 609.
1753. gbinv61.seq - Invertebrate sequence entries, part 61.
1754. gbinv610.seq - Invertebrate sequence entries, part 610.
1755. gbinv611.seq - Invertebrate sequence entries, part 611.
1756. gbinv612.seq - Invertebrate sequence entries, part 612.
1757. gbinv613.seq - Invertebrate sequence entries, part 613.
1758. gbinv614.seq - Invertebrate sequence entries, part 614.
1759. gbinv615.seq - Invertebrate sequence entries, part 615.
1760. gbinv616.seq - Invertebrate sequence entries, part 616.
1761. gbinv617.seq - Invertebrate sequence entries, part 617.
1762. gbinv618.seq - Invertebrate sequence entries, part 618.
1763. gbinv619.seq - Invertebrate sequence entries, part 619.
1764. gbinv62.seq - Invertebrate sequence entries, part 62.
1765. gbinv620.seq - Invertebrate sequence entries, part 620.
1766. gbinv621.seq - Invertebrate sequence entries, part 621.
1767. gbinv622.seq - Invertebrate sequence entries, part 622.
1768. gbinv623.seq - Invertebrate sequence entries, part 623.
1769. gbinv624.seq - Invertebrate sequence entries, part 624.
1770. gbinv625.seq - Invertebrate sequence entries, part 625.
1771. gbinv626.seq - Invertebrate sequence entries, part 626.
1772. gbinv627.seq - Invertebrate sequence entries, part 627.
1773. gbinv628.seq - Invertebrate sequence entries, part 628.
1774. gbinv629.seq - Invertebrate sequence entries, part 629.
1775. gbinv63.seq - Invertebrate sequence entries, part 63.
1776. gbinv630.seq - Invertebrate sequence entries, part 630.
1777. gbinv631.seq - Invertebrate sequence entries, part 631.
1778. gbinv632.seq - Invertebrate sequence entries, part 632.
1779. gbinv633.seq - Invertebrate sequence entries, part 633.
1780. gbinv634.seq - Invertebrate sequence entries, part 634.
1781. gbinv635.seq - Invertebrate sequence entries, part 635.
1782. gbinv636.seq - Invertebrate sequence entries, part 636.
1783. gbinv637.seq - Invertebrate sequence entries, part 637.
1784. gbinv638.seq - Invertebrate sequence entries, part 638.
1785. gbinv639.seq - Invertebrate sequence entries, part 639.
1786. gbinv64.seq - Invertebrate sequence entries, part 64.
1787. gbinv640.seq - Invertebrate sequence entries, part 640.
1788. gbinv641.seq - Invertebrate sequence entries, part 641.
1789. gbinv642.seq - Invertebrate sequence entries, part 642.
1790. gbinv643.seq - Invertebrate sequence entries, part 643.
1791. gbinv644.seq - Invertebrate sequence entries, part 644.
1792. gbinv645.seq - Invertebrate sequence entries, part 645.
1793. gbinv646.seq - Invertebrate sequence entries, part 646.
1794. gbinv647.seq - Invertebrate sequence entries, part 647.
1795. gbinv648.seq - Invertebrate sequence entries, part 648.
1796. gbinv649.seq - Invertebrate sequence entries, part 649.
1797. gbinv65.seq - Invertebrate sequence entries, part 65.
1798. gbinv650.seq - Invertebrate sequence entries, part 650.
1799. gbinv651.seq - Invertebrate sequence entries, part 651.
1800. gbinv652.seq - Invertebrate sequence entries, part 652.
1801. gbinv653.seq - Invertebrate sequence entries, part 653.
1802. gbinv654.seq - Invertebrate sequence entries, part 654.
1803. gbinv655.seq - Invertebrate sequence entries, part 655.
1804. gbinv656.seq - Invertebrate sequence entries, part 656.
1805. gbinv657.seq - Invertebrate sequence entries, part 657.
1806. gbinv658.seq - Invertebrate sequence entries, part 658.
1807. gbinv659.seq - Invertebrate sequence entries, part 659.
1808. gbinv66.seq - Invertebrate sequence entries, part 66.
1809. gbinv660.seq - Invertebrate sequence entries, part 660.
1810. gbinv661.seq - Invertebrate sequence entries, part 661.
1811. gbinv662.seq - Invertebrate sequence entries, part 662.
1812. gbinv663.seq - Invertebrate sequence entries, part 663.
1813. gbinv664.seq - Invertebrate sequence entries, part 664.
1814. gbinv665.seq - Invertebrate sequence entries, part 665.
1815. gbinv666.seq - Invertebrate sequence entries, part 666.
1816. gbinv667.seq - Invertebrate sequence entries, part 667.
1817. gbinv668.seq - Invertebrate sequence entries, part 668.
1818. gbinv669.seq - Invertebrate sequence entries, part 669.
1819. gbinv67.seq - Invertebrate sequence entries, part 67.
1820. gbinv670.seq - Invertebrate sequence entries, part 670.
1821. gbinv671.seq - Invertebrate sequence entries, part 671.
1822. gbinv672.seq - Invertebrate sequence entries, part 672.
1823. gbinv673.seq - Invertebrate sequence entries, part 673.
1824. gbinv674.seq - Invertebrate sequence entries, part 674.
1825. gbinv675.seq - Invertebrate sequence entries, part 675.
1826. gbinv676.seq - Invertebrate sequence entries, part 676.
1827. gbinv677.seq - Invertebrate sequence entries, part 677.
1828. gbinv678.seq - Invertebrate sequence entries, part 678.
1829. gbinv679.seq - Invertebrate sequence entries, part 679.
1830. gbinv68.seq - Invertebrate sequence entries, part 68.
1831. gbinv680.seq - Invertebrate sequence entries, part 680.
1832. gbinv681.seq - Invertebrate sequence entries, part 681.
1833. gbinv682.seq - Invertebrate sequence entries, part 682.
1834. gbinv683.seq - Invertebrate sequence entries, part 683.
1835. gbinv684.seq - Invertebrate sequence entries, part 684.
1836. gbinv685.seq - Invertebrate sequence entries, part 685.
1837. gbinv686.seq - Invertebrate sequence entries, part 686.
1838. gbinv687.seq - Invertebrate sequence entries, part 687.
1839. gbinv688.seq - Invertebrate sequence entries, part 688.
1840. gbinv689.seq - Invertebrate sequence entries, part 689.
1841. gbinv69.seq - Invertebrate sequence entries, part 69.
1842. gbinv690.seq - Invertebrate sequence entries, part 690.
1843. gbinv691.seq - Invertebrate sequence entries, part 691.
1844. gbinv692.seq - Invertebrate sequence entries, part 692.
1845. gbinv693.seq - Invertebrate sequence entries, part 693.
1846. gbinv694.seq - Invertebrate sequence entries, part 694.
1847. gbinv695.seq - Invertebrate sequence entries, part 695.
1848. gbinv696.seq - Invertebrate sequence entries, part 696.
1849. gbinv697.seq - Invertebrate sequence entries, part 697.
1850. gbinv698.seq - Invertebrate sequence entries, part 698.
1851. gbinv699.seq - Invertebrate sequence entries, part 699.
1852. gbinv7.seq - Invertebrate sequence entries, part 7.
1853. gbinv70.seq - Invertebrate sequence entries, part 70.
1854. gbinv700.seq - Invertebrate sequence entries, part 700.
1855. gbinv701.seq - Invertebrate sequence entries, part 701.
1856. gbinv702.seq - Invertebrate sequence entries, part 702.
1857. gbinv703.seq - Invertebrate sequence entries, part 703.
1858. gbinv704.seq - Invertebrate sequence entries, part 704.
1859. gbinv705.seq - Invertebrate sequence entries, part 705.
1860. gbinv706.seq - Invertebrate sequence entries, part 706.
1861. gbinv707.seq - Invertebrate sequence entries, part 707.
1862. gbinv708.seq - Invertebrate sequence entries, part 708.
1863. gbinv709.seq - Invertebrate sequence entries, part 709.
1864. gbinv71.seq - Invertebrate sequence entries, part 71.
1865. gbinv710.seq - Invertebrate sequence entries, part 710.
1866. gbinv711.seq - Invertebrate sequence entries, part 711.
1867. gbinv712.seq - Invertebrate sequence entries, part 712.
1868. gbinv713.seq - Invertebrate sequence entries, part 713.
1869. gbinv714.seq - Invertebrate sequence entries, part 714.
1870. gbinv715.seq - Invertebrate sequence entries, part 715.
1871. gbinv716.seq - Invertebrate sequence entries, part 716.
1872. gbinv717.seq - Invertebrate sequence entries, part 717.
1873. gbinv718.seq - Invertebrate sequence entries, part 718.
1874. gbinv719.seq - Invertebrate sequence entries, part 719.
1875. gbinv72.seq - Invertebrate sequence entries, part 72.
1876. gbinv720.seq - Invertebrate sequence entries, part 720.
1877. gbinv721.seq - Invertebrate sequence entries, part 721.
1878. gbinv722.seq - Invertebrate sequence entries, part 722.
1879. gbinv723.seq - Invertebrate sequence entries, part 723.
1880. gbinv724.seq - Invertebrate sequence entries, part 724.
1881. gbinv725.seq - Invertebrate sequence entries, part 725.
1882. gbinv726.seq - Invertebrate sequence entries, part 726.
1883. gbinv727.seq - Invertebrate sequence entries, part 727.
1884. gbinv728.seq - Invertebrate sequence entries, part 728.
1885. gbinv729.seq - Invertebrate sequence entries, part 729.
1886. gbinv73.seq - Invertebrate sequence entries, part 73.
1887. gbinv730.seq - Invertebrate sequence entries, part 730.
1888. gbinv731.seq - Invertebrate sequence entries, part 731.
1889. gbinv732.seq - Invertebrate sequence entries, part 732.
1890. gbinv733.seq - Invertebrate sequence entries, part 733.
1891. gbinv734.seq - Invertebrate sequence entries, part 734.
1892. gbinv735.seq - Invertebrate sequence entries, part 735.
1893. gbinv736.seq - Invertebrate sequence entries, part 736.
1894. gbinv737.seq - Invertebrate sequence entries, part 737.
1895. gbinv738.seq - Invertebrate sequence entries, part 738.
1896. gbinv739.seq - Invertebrate sequence entries, part 739.
1897. gbinv74.seq - Invertebrate sequence entries, part 74.
1898. gbinv740.seq - Invertebrate sequence entries, part 740.
1899. gbinv741.seq - Invertebrate sequence entries, part 741.
1900. gbinv742.seq - Invertebrate sequence entries, part 742.
1901. gbinv743.seq - Invertebrate sequence entries, part 743.
1902. gbinv744.seq - Invertebrate sequence entries, part 744.
1903. gbinv745.seq - Invertebrate sequence entries, part 745.
1904. gbinv746.seq - Invertebrate sequence entries, part 746.
1905. gbinv747.seq - Invertebrate sequence entries, part 747.
1906. gbinv748.seq - Invertebrate sequence entries, part 748.
1907. gbinv749.seq - Invertebrate sequence entries, part 749.
1908. gbinv75.seq - Invertebrate sequence entries, part 75.
1909. gbinv750.seq - Invertebrate sequence entries, part 750.
1910. gbinv751.seq - Invertebrate sequence entries, part 751.
1911. gbinv752.seq - Invertebrate sequence entries, part 752.
1912. gbinv753.seq - Invertebrate sequence entries, part 753.
1913. gbinv754.seq - Invertebrate sequence entries, part 754.
1914. gbinv755.seq - Invertebrate sequence entries, part 755.
1915. gbinv756.seq - Invertebrate sequence entries, part 756.
1916. gbinv757.seq - Invertebrate sequence entries, part 757.
1917. gbinv758.seq - Invertebrate sequence entries, part 758.
1918. gbinv759.seq - Invertebrate sequence entries, part 759.
1919. gbinv76.seq - Invertebrate sequence entries, part 76.
1920. gbinv760.seq - Invertebrate sequence entries, part 760.
1921. gbinv761.seq - Invertebrate sequence entries, part 761.
1922. gbinv762.seq - Invertebrate sequence entries, part 762.
1923. gbinv763.seq - Invertebrate sequence entries, part 763.
1924. gbinv764.seq - Invertebrate sequence entries, part 764.
1925. gbinv765.seq - Invertebrate sequence entries, part 765.
1926. gbinv766.seq - Invertebrate sequence entries, part 766.
1927. gbinv767.seq - Invertebrate sequence entries, part 767.
1928. gbinv768.seq - Invertebrate sequence entries, part 768.
1929. gbinv769.seq - Invertebrate sequence entries, part 769.
1930. gbinv77.seq - Invertebrate sequence entries, part 77.
1931. gbinv770.seq - Invertebrate sequence entries, part 770.
1932. gbinv771.seq - Invertebrate sequence entries, part 771.
1933. gbinv772.seq - Invertebrate sequence entries, part 772.
1934. gbinv773.seq - Invertebrate sequence entries, part 773.
1935. gbinv774.seq - Invertebrate sequence entries, part 774.
1936. gbinv775.seq - Invertebrate sequence entries, part 775.
1937. gbinv776.seq - Invertebrate sequence entries, part 776.
1938. gbinv777.seq - Invertebrate sequence entries, part 777.
1939. gbinv778.seq - Invertebrate sequence entries, part 778.
1940. gbinv779.seq - Invertebrate sequence entries, part 779.
1941. gbinv78.seq - Invertebrate sequence entries, part 78.
1942. gbinv780.seq - Invertebrate sequence entries, part 780.
1943. gbinv781.seq - Invertebrate sequence entries, part 781.
1944. gbinv782.seq - Invertebrate sequence entries, part 782.
1945. gbinv783.seq - Invertebrate sequence entries, part 783.
1946. gbinv784.seq - Invertebrate sequence entries, part 784.
1947. gbinv785.seq - Invertebrate sequence entries, part 785.
1948. gbinv786.seq - Invertebrate sequence entries, part 786.
1949. gbinv787.seq - Invertebrate sequence entries, part 787.
1950. gbinv788.seq - Invertebrate sequence entries, part 788.
1951. gbinv789.seq - Invertebrate sequence entries, part 789.
1952. gbinv79.seq - Invertebrate sequence entries, part 79.
1953. gbinv790.seq - Invertebrate sequence entries, part 790.
1954. gbinv791.seq - Invertebrate sequence entries, part 791.
1955. gbinv792.seq - Invertebrate sequence entries, part 792.
1956. gbinv793.seq - Invertebrate sequence entries, part 793.
1957. gbinv794.seq - Invertebrate sequence entries, part 794.
1958. gbinv795.seq - Invertebrate sequence entries, part 795.
1959. gbinv796.seq - Invertebrate sequence entries, part 796.
1960. gbinv797.seq - Invertebrate sequence entries, part 797.
1961. gbinv798.seq - Invertebrate sequence entries, part 798.
1962. gbinv799.seq - Invertebrate sequence entries, part 799.
1963. gbinv8.seq - Invertebrate sequence entries, part 8.
1964. gbinv80.seq - Invertebrate sequence entries, part 80.
1965. gbinv800.seq - Invertebrate sequence entries, part 800.
1966. gbinv801.seq - Invertebrate sequence entries, part 801.
1967. gbinv802.seq - Invertebrate sequence entries, part 802.
1968. gbinv803.seq - Invertebrate sequence entries, part 803.
1969. gbinv804.seq - Invertebrate sequence entries, part 804.
1970. gbinv805.seq - Invertebrate sequence entries, part 805.
1971. gbinv806.seq - Invertebrate sequence entries, part 806.
1972. gbinv807.seq - Invertebrate sequence entries, part 807.
1973. gbinv808.seq - Invertebrate sequence entries, part 808.
1974. gbinv809.seq - Invertebrate sequence entries, part 809.
1975. gbinv81.seq - Invertebrate sequence entries, part 81.
1976. gbinv810.seq - Invertebrate sequence entries, part 810.
1977. gbinv811.seq - Invertebrate sequence entries, part 811.
1978. gbinv812.seq - Invertebrate sequence entries, part 812.
1979. gbinv813.seq - Invertebrate sequence entries, part 813.
1980. gbinv814.seq - Invertebrate sequence entries, part 814.
1981. gbinv815.seq - Invertebrate sequence entries, part 815.
1982. gbinv816.seq - Invertebrate sequence entries, part 816.
1983. gbinv817.seq - Invertebrate sequence entries, part 817.
1984. gbinv818.seq - Invertebrate sequence entries, part 818.
1985. gbinv819.seq - Invertebrate sequence entries, part 819.
1986. gbinv82.seq - Invertebrate sequence entries, part 82.
1987. gbinv820.seq - Invertebrate sequence entries, part 820.
1988. gbinv821.seq - Invertebrate sequence entries, part 821.
1989. gbinv822.seq - Invertebrate sequence entries, part 822.
1990. gbinv823.seq - Invertebrate sequence entries, part 823.
1991. gbinv824.seq - Invertebrate sequence entries, part 824.
1992. gbinv825.seq - Invertebrate sequence entries, part 825.
1993. gbinv826.seq - Invertebrate sequence entries, part 826.
1994. gbinv827.seq - Invertebrate sequence entries, part 827.
1995. gbinv828.seq - Invertebrate sequence entries, part 828.
1996. gbinv829.seq - Invertebrate sequence entries, part 829.
1997. gbinv83.seq - Invertebrate sequence entries, part 83.
1998. gbinv830.seq - Invertebrate sequence entries, part 830.
1999. gbinv831.seq - Invertebrate sequence entries, part 831.
2000. gbinv832.seq - Invertebrate sequence entries, part 832.
2001. gbinv833.seq - Invertebrate sequence entries, part 833.
2002. gbinv834.seq - Invertebrate sequence entries, part 834.
2003. gbinv835.seq - Invertebrate sequence entries, part 835.
2004. gbinv836.seq - Invertebrate sequence entries, part 836.
2005. gbinv837.seq - Invertebrate sequence entries, part 837.
2006. gbinv838.seq - Invertebrate sequence entries, part 838.
2007. gbinv839.seq - Invertebrate sequence entries, part 839.
2008. gbinv84.seq - Invertebrate sequence entries, part 84.
2009. gbinv840.seq - Invertebrate sequence entries, part 840.
2010. gbinv841.seq - Invertebrate sequence entries, part 841.
2011. gbinv842.seq - Invertebrate sequence entries, part 842.
2012. gbinv843.seq - Invertebrate sequence entries, part 843.
2013. gbinv844.seq - Invertebrate sequence entries, part 844.
2014. gbinv845.seq - Invertebrate sequence entries, part 845.
2015. gbinv846.seq - Invertebrate sequence entries, part 846.
2016. gbinv847.seq - Invertebrate sequence entries, part 847.
2017. gbinv848.seq - Invertebrate sequence entries, part 848.
2018. gbinv849.seq - Invertebrate sequence entries, part 849.
2019. gbinv85.seq - Invertebrate sequence entries, part 85.
2020. gbinv850.seq - Invertebrate sequence entries, part 850.
2021. gbinv851.seq - Invertebrate sequence entries, part 851.
2022. gbinv852.seq - Invertebrate sequence entries, part 852.
2023. gbinv853.seq - Invertebrate sequence entries, part 853.
2024. gbinv854.seq - Invertebrate sequence entries, part 854.
2025. gbinv855.seq - Invertebrate sequence entries, part 855.
2026. gbinv856.seq - Invertebrate sequence entries, part 856.
2027. gbinv857.seq - Invertebrate sequence entries, part 857.
2028. gbinv858.seq - Invertebrate sequence entries, part 858.
2029. gbinv859.seq - Invertebrate sequence entries, part 859.
2030. gbinv86.seq - Invertebrate sequence entries, part 86.
2031. gbinv860.seq - Invertebrate sequence entries, part 860.
2032. gbinv861.seq - Invertebrate sequence entries, part 861.
2033. gbinv862.seq - Invertebrate sequence entries, part 862.
2034. gbinv863.seq - Invertebrate sequence entries, part 863.
2035. gbinv864.seq - Invertebrate sequence entries, part 864.
2036. gbinv865.seq - Invertebrate sequence entries, part 865.
2037. gbinv866.seq - Invertebrate sequence entries, part 866.
2038. gbinv867.seq - Invertebrate sequence entries, part 867.
2039. gbinv868.seq - Invertebrate sequence entries, part 868.
2040. gbinv869.seq - Invertebrate sequence entries, part 869.
2041. gbinv87.seq - Invertebrate sequence entries, part 87.
2042. gbinv870.seq - Invertebrate sequence entries, part 870.
2043. gbinv871.seq - Invertebrate sequence entries, part 871.
2044. gbinv872.seq - Invertebrate sequence entries, part 872.
2045. gbinv873.seq - Invertebrate sequence entries, part 873.
2046. gbinv874.seq - Invertebrate sequence entries, part 874.
2047. gbinv875.seq - Invertebrate sequence entries, part 875.
2048. gbinv876.seq - Invertebrate sequence entries, part 876.
2049. gbinv877.seq - Invertebrate sequence entries, part 877.
2050. gbinv878.seq - Invertebrate sequence entries, part 878.
2051. gbinv879.seq - Invertebrate sequence entries, part 879.
2052. gbinv88.seq - Invertebrate sequence entries, part 88.
2053. gbinv880.seq - Invertebrate sequence entries, part 880.
2054. gbinv881.seq - Invertebrate sequence entries, part 881.
2055. gbinv882.seq - Invertebrate sequence entries, part 882.
2056. gbinv883.seq - Invertebrate sequence entries, part 883.
2057. gbinv884.seq - Invertebrate sequence entries, part 884.
2058. gbinv885.seq - Invertebrate sequence entries, part 885.
2059. gbinv886.seq - Invertebrate sequence entries, part 886.
2060. gbinv887.seq - Invertebrate sequence entries, part 887.
2061. gbinv888.seq - Invertebrate sequence entries, part 888.
2062. gbinv889.seq - Invertebrate sequence entries, part 889.
2063. gbinv89.seq - Invertebrate sequence entries, part 89.
2064. gbinv890.seq - Invertebrate sequence entries, part 890.
2065. gbinv891.seq - Invertebrate sequence entries, part 891.
2066. gbinv892.seq - Invertebrate sequence entries, part 892.
2067. gbinv893.seq - Invertebrate sequence entries, part 893.
2068. gbinv894.seq - Invertebrate sequence entries, part 894.
2069. gbinv895.seq - Invertebrate sequence entries, part 895.
2070. gbinv896.seq - Invertebrate sequence entries, part 896.
2071. gbinv897.seq - Invertebrate sequence entries, part 897.
2072. gbinv898.seq - Invertebrate sequence entries, part 898.
2073. gbinv899.seq - Invertebrate sequence entries, part 899.
2074. gbinv9.seq - Invertebrate sequence entries, part 9.
2075. gbinv90.seq - Invertebrate sequence entries, part 90.
2076. gbinv900.seq - Invertebrate sequence entries, part 900.
2077. gbinv901.seq - Invertebrate sequence entries, part 901.
2078. gbinv902.seq - Invertebrate sequence entries, part 902.
2079. gbinv903.seq - Invertebrate sequence entries, part 903.
2080. gbinv904.seq - Invertebrate sequence entries, part 904.
2081. gbinv905.seq - Invertebrate sequence entries, part 905.
2082. gbinv906.seq - Invertebrate sequence entries, part 906.
2083. gbinv907.seq - Invertebrate sequence entries, part 907.
2084. gbinv908.seq - Invertebrate sequence entries, part 908.
2085. gbinv909.seq - Invertebrate sequence entries, part 909.
2086. gbinv91.seq - Invertebrate sequence entries, part 91.
2087. gbinv910.seq - Invertebrate sequence entries, part 910.
2088. gbinv911.seq - Invertebrate sequence entries, part 911.
2089. gbinv912.seq - Invertebrate sequence entries, part 912.
2090. gbinv913.seq - Invertebrate sequence entries, part 913.
2091. gbinv914.seq - Invertebrate sequence entries, part 914.
2092. gbinv915.seq - Invertebrate sequence entries, part 915.
2093. gbinv916.seq - Invertebrate sequence entries, part 916.
2094. gbinv917.seq - Invertebrate sequence entries, part 917.
2095. gbinv918.seq - Invertebrate sequence entries, part 918.
2096. gbinv919.seq - Invertebrate sequence entries, part 919.
2097. gbinv92.seq - Invertebrate sequence entries, part 92.
2098. gbinv920.seq - Invertebrate sequence entries, part 920.
2099. gbinv921.seq - Invertebrate sequence entries, part 921.
2100. gbinv922.seq - Invertebrate sequence entries, part 922.
2101. gbinv923.seq - Invertebrate sequence entries, part 923.
2102. gbinv924.seq - Invertebrate sequence entries, part 924.
2103. gbinv925.seq - Invertebrate sequence entries, part 925.
2104. gbinv926.seq - Invertebrate sequence entries, part 926.
2105. gbinv927.seq - Invertebrate sequence entries, part 927.
2106. gbinv928.seq - Invertebrate sequence entries, part 928.
2107. gbinv929.seq - Invertebrate sequence entries, part 929.
2108. gbinv93.seq - Invertebrate sequence entries, part 93.
2109. gbinv930.seq - Invertebrate sequence entries, part 930.
2110. gbinv931.seq - Invertebrate sequence entries, part 931.
2111. gbinv932.seq - Invertebrate sequence entries, part 932.
2112. gbinv933.seq - Invertebrate sequence entries, part 933.
2113. gbinv934.seq - Invertebrate sequence entries, part 934.
2114. gbinv935.seq - Invertebrate sequence entries, part 935.
2115. gbinv936.seq - Invertebrate sequence entries, part 936.
2116. gbinv937.seq - Invertebrate sequence entries, part 937.
2117. gbinv938.seq - Invertebrate sequence entries, part 938.
2118. gbinv939.seq - Invertebrate sequence entries, part 939.
2119. gbinv94.seq - Invertebrate sequence entries, part 94.
2120. gbinv940.seq - Invertebrate sequence entries, part 940.
2121. gbinv941.seq - Invertebrate sequence entries, part 941.
2122. gbinv942.seq - Invertebrate sequence entries, part 942.
2123. gbinv943.seq - Invertebrate sequence entries, part 943.
2124. gbinv944.seq - Invertebrate sequence entries, part 944.
2125. gbinv945.seq - Invertebrate sequence entries, part 945.
2126. gbinv946.seq - Invertebrate sequence entries, part 946.
2127. gbinv947.seq - Invertebrate sequence entries, part 947.
2128. gbinv948.seq - Invertebrate sequence entries, part 948.
2129. gbinv949.seq - Invertebrate sequence entries, part 949.
2130. gbinv95.seq - Invertebrate sequence entries, part 95.
2131. gbinv950.seq - Invertebrate sequence entries, part 950.
2132. gbinv951.seq - Invertebrate sequence entries, part 951.
2133. gbinv952.seq - Invertebrate sequence entries, part 952.
2134. gbinv953.seq - Invertebrate sequence entries, part 953.
2135. gbinv954.seq - Invertebrate sequence entries, part 954.
2136. gbinv955.seq - Invertebrate sequence entries, part 955.
2137. gbinv956.seq - Invertebrate sequence entries, part 956.
2138. gbinv957.seq - Invertebrate sequence entries, part 957.
2139. gbinv958.seq - Invertebrate sequence entries, part 958.
2140. gbinv959.seq - Invertebrate sequence entries, part 959.
2141. gbinv96.seq - Invertebrate sequence entries, part 96.
2142. gbinv960.seq - Invertebrate sequence entries, part 960.
2143. gbinv961.seq - Invertebrate sequence entries, part 961.
2144. gbinv962.seq - Invertebrate sequence entries, part 962.
2145. gbinv963.seq - Invertebrate sequence entries, part 963.
2146. gbinv964.seq - Invertebrate sequence entries, part 964.
2147. gbinv965.seq - Invertebrate sequence entries, part 965.
2148. gbinv966.seq - Invertebrate sequence entries, part 966.
2149. gbinv967.seq - Invertebrate sequence entries, part 967.
2150. gbinv968.seq - Invertebrate sequence entries, part 968.
2151. gbinv969.seq - Invertebrate sequence entries, part 969.
2152. gbinv97.seq - Invertebrate sequence entries, part 97.
2153. gbinv970.seq - Invertebrate sequence entries, part 970.
2154. gbinv971.seq - Invertebrate sequence entries, part 971.
2155. gbinv972.seq - Invertebrate sequence entries, part 972.
2156. gbinv973.seq - Invertebrate sequence entries, part 973.
2157. gbinv974.seq - Invertebrate sequence entries, part 974.
2158. gbinv975.seq - Invertebrate sequence entries, part 975.
2159. gbinv976.seq - Invertebrate sequence entries, part 976.
2160. gbinv977.seq - Invertebrate sequence entries, part 977.
2161. gbinv978.seq - Invertebrate sequence entries, part 978.
2162. gbinv979.seq - Invertebrate sequence entries, part 979.
2163. gbinv98.seq - Invertebrate sequence entries, part 98.
2164. gbinv980.seq - Invertebrate sequence entries, part 980.
2165. gbinv981.seq - Invertebrate sequence entries, part 981.
2166. gbinv982.seq - Invertebrate sequence entries, part 982.
2167. gbinv983.seq - Invertebrate sequence entries, part 983.
2168. gbinv984.seq - Invertebrate sequence entries, part 984.
2169. gbinv985.seq - Invertebrate sequence entries, part 985.
2170. gbinv986.seq - Invertebrate sequence entries, part 986.
2171. gbinv987.seq - Invertebrate sequence entries, part 987.
2172. gbinv988.seq - Invertebrate sequence entries, part 988.
2173. gbinv989.seq - Invertebrate sequence entries, part 989.
2174. gbinv99.seq - Invertebrate sequence entries, part 99.
2175. gbinv990.seq - Invertebrate sequence entries, part 990.
2176. gbinv991.seq - Invertebrate sequence entries, part 991.
2177. gbinv992.seq - Invertebrate sequence entries, part 992.
2178. gbinv993.seq - Invertebrate sequence entries, part 993.
2179. gbinv994.seq - Invertebrate sequence entries, part 994.
2180. gbinv995.seq - Invertebrate sequence entries, part 995.
2181. gbinv996.seq - Invertebrate sequence entries, part 996.
2182. gbinv997.seq - Invertebrate sequence entries, part 997.
2183. gbinv998.seq - Invertebrate sequence entries, part 998.
2184. gbinv999.seq - Invertebrate sequence entries, part 999.
2185. gbmam1.seq - Other mammalian sequence entries, part 1.
2186. gbmam10.seq - Other mammalian sequence entries, part 10.
2187. gbmam100.seq - Other mammalian sequence entries, part 100.
2188. gbmam101.seq - Other mammalian sequence entries, part 101.
2189. gbmam102.seq - Other mammalian sequence entries, part 102.
2190. gbmam103.seq - Other mammalian sequence entries, part 103.
2191. gbmam104.seq - Other mammalian sequence entries, part 104.
2192. gbmam105.seq - Other mammalian sequence entries, part 105.
2193. gbmam106.seq - Other mammalian sequence entries, part 106.
2194. gbmam107.seq - Other mammalian sequence entries, part 107.
2195. gbmam108.seq - Other mammalian sequence entries, part 108.
2196. gbmam109.seq - Other mammalian sequence entries, part 109.
2197. gbmam11.seq - Other mammalian sequence entries, part 11.
2198. gbmam110.seq - Other mammalian sequence entries, part 110.
2199. gbmam111.seq - Other mammalian sequence entries, part 111.
2200. gbmam112.seq - Other mammalian sequence entries, part 112.
2201. gbmam113.seq - Other mammalian sequence entries, part 113.
2202. gbmam114.seq - Other mammalian sequence entries, part 114.
2203. gbmam115.seq - Other mammalian sequence entries, part 115.
2204. gbmam116.seq - Other mammalian sequence entries, part 116.
2205. gbmam117.seq - Other mammalian sequence entries, part 117.
2206. gbmam118.seq - Other mammalian sequence entries, part 118.
2207. gbmam119.seq - Other mammalian sequence entries, part 119.
2208. gbmam12.seq - Other mammalian sequence entries, part 12.
2209. gbmam120.seq - Other mammalian sequence entries, part 120.
2210. gbmam121.seq - Other mammalian sequence entries, part 121.
2211. gbmam122.seq - Other mammalian sequence entries, part 122.
2212. gbmam123.seq - Other mammalian sequence entries, part 123.
2213. gbmam124.seq - Other mammalian sequence entries, part 124.
2214. gbmam125.seq - Other mammalian sequence entries, part 125.
2215. gbmam126.seq - Other mammalian sequence entries, part 126.
2216. gbmam127.seq - Other mammalian sequence entries, part 127.
2217. gbmam128.seq - Other mammalian sequence entries, part 128.
2218. gbmam129.seq - Other mammalian sequence entries, part 129.
2219. gbmam13.seq - Other mammalian sequence entries, part 13.
2220. gbmam130.seq - Other mammalian sequence entries, part 130.
2221. gbmam131.seq - Other mammalian sequence entries, part 131.
2222. gbmam132.seq - Other mammalian sequence entries, part 132.
2223. gbmam133.seq - Other mammalian sequence entries, part 133.
2224. gbmam134.seq - Other mammalian sequence entries, part 134.
2225. gbmam135.seq - Other mammalian sequence entries, part 135.
2226. gbmam136.seq - Other mammalian sequence entries, part 136.
2227. gbmam137.seq - Other mammalian sequence entries, part 137.
2228. gbmam138.seq - Other mammalian sequence entries, part 138.
2229. gbmam139.seq - Other mammalian sequence entries, part 139.
2230. gbmam14.seq - Other mammalian sequence entries, part 14.
2231. gbmam140.seq - Other mammalian sequence entries, part 140.
2232. gbmam141.seq - Other mammalian sequence entries, part 141.
2233. gbmam142.seq - Other mammalian sequence entries, part 142.
2234. gbmam143.seq - Other mammalian sequence entries, part 143.
2235. gbmam144.seq - Other mammalian sequence entries, part 144.
2236. gbmam145.seq - Other mammalian sequence entries, part 145.
2237. gbmam146.seq - Other mammalian sequence entries, part 146.
2238. gbmam147.seq - Other mammalian sequence entries, part 147.
2239. gbmam148.seq - Other mammalian sequence entries, part 148.
2240. gbmam149.seq - Other mammalian sequence entries, part 149.
2241. gbmam15.seq - Other mammalian sequence entries, part 15.
2242. gbmam150.seq - Other mammalian sequence entries, part 150.
2243. gbmam151.seq - Other mammalian sequence entries, part 151.
2244. gbmam152.seq - Other mammalian sequence entries, part 152.
2245. gbmam153.seq - Other mammalian sequence entries, part 153.
2246. gbmam154.seq - Other mammalian sequence entries, part 154.
2247. gbmam155.seq - Other mammalian sequence entries, part 155.
2248. gbmam156.seq - Other mammalian sequence entries, part 156.
2249. gbmam157.seq - Other mammalian sequence entries, part 157.
2250. gbmam158.seq - Other mammalian sequence entries, part 158.
2251. gbmam159.seq - Other mammalian sequence entries, part 159.
2252. gbmam16.seq - Other mammalian sequence entries, part 16.
2253. gbmam160.seq - Other mammalian sequence entries, part 160.
2254. gbmam161.seq - Other mammalian sequence entries, part 161.
2255. gbmam162.seq - Other mammalian sequence entries, part 162.
2256. gbmam163.seq - Other mammalian sequence entries, part 163.
2257. gbmam164.seq - Other mammalian sequence entries, part 164.
2258. gbmam165.seq - Other mammalian sequence entries, part 165.
2259. gbmam166.seq - Other mammalian sequence entries, part 166.
2260. gbmam167.seq - Other mammalian sequence entries, part 167.
2261. gbmam168.seq - Other mammalian sequence entries, part 168.
2262. gbmam169.seq - Other mammalian sequence entries, part 169.
2263. gbmam17.seq - Other mammalian sequence entries, part 17.
2264. gbmam170.seq - Other mammalian sequence entries, part 170.
2265. gbmam171.seq - Other mammalian sequence entries, part 171.
2266. gbmam172.seq - Other mammalian sequence entries, part 172.
2267. gbmam173.seq - Other mammalian sequence entries, part 173.
2268. gbmam174.seq - Other mammalian sequence entries, part 174.
2269. gbmam175.seq - Other mammalian sequence entries, part 175.
2270. gbmam176.seq - Other mammalian sequence entries, part 176.
2271. gbmam177.seq - Other mammalian sequence entries, part 177.
2272. gbmam178.seq - Other mammalian sequence entries, part 178.
2273. gbmam179.seq - Other mammalian sequence entries, part 179.
2274. gbmam18.seq - Other mammalian sequence entries, part 18.
2275. gbmam180.seq - Other mammalian sequence entries, part 180.
2276. gbmam181.seq - Other mammalian sequence entries, part 181.
2277. gbmam182.seq - Other mammalian sequence entries, part 182.
2278. gbmam183.seq - Other mammalian sequence entries, part 183.
2279. gbmam184.seq - Other mammalian sequence entries, part 184.
2280. gbmam185.seq - Other mammalian sequence entries, part 185.
2281. gbmam186.seq - Other mammalian sequence entries, part 186.
2282. gbmam187.seq - Other mammalian sequence entries, part 187.
2283. gbmam188.seq - Other mammalian sequence entries, part 188.
2284. gbmam189.seq - Other mammalian sequence entries, part 189.
2285. gbmam19.seq - Other mammalian sequence entries, part 19.
2286. gbmam190.seq - Other mammalian sequence entries, part 190.
2287. gbmam191.seq - Other mammalian sequence entries, part 191.
2288. gbmam192.seq - Other mammalian sequence entries, part 192.
2289. gbmam193.seq - Other mammalian sequence entries, part 193.
2290. gbmam2.seq - Other mammalian sequence entries, part 2.
2291. gbmam20.seq - Other mammalian sequence entries, part 20.
2292. gbmam21.seq - Other mammalian sequence entries, part 21.
2293. gbmam22.seq - Other mammalian sequence entries, part 22.
2294. gbmam23.seq - Other mammalian sequence entries, part 23.
2295. gbmam24.seq - Other mammalian sequence entries, part 24.
2296. gbmam25.seq - Other mammalian sequence entries, part 25.
2297. gbmam26.seq - Other mammalian sequence entries, part 26.
2298. gbmam27.seq - Other mammalian sequence entries, part 27.
2299. gbmam28.seq - Other mammalian sequence entries, part 28.
2300. gbmam29.seq - Other mammalian sequence entries, part 29.
2301. gbmam3.seq - Other mammalian sequence entries, part 3.
2302. gbmam30.seq - Other mammalian sequence entries, part 30.
2303. gbmam31.seq - Other mammalian sequence entries, part 31.
2304. gbmam32.seq - Other mammalian sequence entries, part 32.
2305. gbmam33.seq - Other mammalian sequence entries, part 33.
2306. gbmam34.seq - Other mammalian sequence entries, part 34.
2307. gbmam35.seq - Other mammalian sequence entries, part 35.
2308. gbmam36.seq - Other mammalian sequence entries, part 36.
2309. gbmam37.seq - Other mammalian sequence entries, part 37.
2310. gbmam38.seq - Other mammalian sequence entries, part 38.
2311. gbmam39.seq - Other mammalian sequence entries, part 39.
2312. gbmam4.seq - Other mammalian sequence entries, part 4.
2313. gbmam40.seq - Other mammalian sequence entries, part 40.
2314. gbmam41.seq - Other mammalian sequence entries, part 41.
2315. gbmam42.seq - Other mammalian sequence entries, part 42.
2316. gbmam43.seq - Other mammalian sequence entries, part 43.
2317. gbmam44.seq - Other mammalian sequence entries, part 44.
2318. gbmam45.seq - Other mammalian sequence entries, part 45.
2319. gbmam46.seq - Other mammalian sequence entries, part 46.
2320. gbmam47.seq - Other mammalian sequence entries, part 47.
2321. gbmam48.seq - Other mammalian sequence entries, part 48.
2322. gbmam49.seq - Other mammalian sequence entries, part 49.
2323. gbmam5.seq - Other mammalian sequence entries, part 5.
2324. gbmam50.seq - Other mammalian sequence entries, part 50.
2325. gbmam51.seq - Other mammalian sequence entries, part 51.
2326. gbmam52.seq - Other mammalian sequence entries, part 52.
2327. gbmam53.seq - Other mammalian sequence entries, part 53.
2328. gbmam54.seq - Other mammalian sequence entries, part 54.
2329. gbmam55.seq - Other mammalian sequence entries, part 55.
2330. gbmam56.seq - Other mammalian sequence entries, part 56.
2331. gbmam57.seq - Other mammalian sequence entries, part 57.
2332. gbmam58.seq - Other mammalian sequence entries, part 58.
2333. gbmam59.seq - Other mammalian sequence entries, part 59.
2334. gbmam6.seq - Other mammalian sequence entries, part 6.
2335. gbmam60.seq - Other mammalian sequence entries, part 60.
2336. gbmam61.seq - Other mammalian sequence entries, part 61.
2337. gbmam62.seq - Other mammalian sequence entries, part 62.
2338. gbmam63.seq - Other mammalian sequence entries, part 63.
2339. gbmam64.seq - Other mammalian sequence entries, part 64.
2340. gbmam65.seq - Other mammalian sequence entries, part 65.
2341. gbmam66.seq - Other mammalian sequence entries, part 66.
2342. gbmam67.seq - Other mammalian sequence entries, part 67.
2343. gbmam68.seq - Other mammalian sequence entries, part 68.
2344. gbmam69.seq - Other mammalian sequence entries, part 69.
2345. gbmam7.seq - Other mammalian sequence entries, part 7.
2346. gbmam70.seq - Other mammalian sequence entries, part 70.
2347. gbmam71.seq - Other mammalian sequence entries, part 71.
2348. gbmam72.seq - Other mammalian sequence entries, part 72.
2349. gbmam73.seq - Other mammalian sequence entries, part 73.
2350. gbmam74.seq - Other mammalian sequence entries, part 74.
2351. gbmam75.seq - Other mammalian sequence entries, part 75.
2352. gbmam76.seq - Other mammalian sequence entries, part 76.
2353. gbmam77.seq - Other mammalian sequence entries, part 77.
2354. gbmam78.seq - Other mammalian sequence entries, part 78.
2355. gbmam79.seq - Other mammalian sequence entries, part 79.
2356. gbmam8.seq - Other mammalian sequence entries, part 8.
2357. gbmam80.seq - Other mammalian sequence entries, part 80.
2358. gbmam81.seq - Other mammalian sequence entries, part 81.
2359. gbmam82.seq - Other mammalian sequence entries, part 82.
2360. gbmam83.seq - Other mammalian sequence entries, part 83.
2361. gbmam84.seq - Other mammalian sequence entries, part 84.
2362. gbmam85.seq - Other mammalian sequence entries, part 85.
2363. gbmam86.seq - Other mammalian sequence entries, part 86.
2364. gbmam87.seq - Other mammalian sequence entries, part 87.
2365. gbmam88.seq - Other mammalian sequence entries, part 88.
2366. gbmam89.seq - Other mammalian sequence entries, part 89.
2367. gbmam9.seq - Other mammalian sequence entries, part 9.
2368. gbmam90.seq - Other mammalian sequence entries, part 90.
2369. gbmam91.seq - Other mammalian sequence entries, part 91.
2370. gbmam92.seq - Other mammalian sequence entries, part 92.
2371. gbmam93.seq - Other mammalian sequence entries, part 93.
2372. gbmam94.seq - Other mammalian sequence entries, part 94.
2373. gbmam95.seq - Other mammalian sequence entries, part 95.
2374. gbmam96.seq - Other mammalian sequence entries, part 96.
2375. gbmam97.seq - Other mammalian sequence entries, part 97.
2376. gbmam98.seq - Other mammalian sequence entries, part 98.
2377. gbmam99.seq - Other mammalian sequence entries, part 99.
2378. gbnew.txt - Accession numbers of entries new since the previous release.
2379. gbpat1.seq - Patent sequence entries, part 1.
2380. gbpat10.seq - Patent sequence entries, part 10.
2381. gbpat100.seq - Patent sequence entries, part 100.
2382. gbpat101.seq - Patent sequence entries, part 101.
2383. gbpat102.seq - Patent sequence entries, part 102.
2384. gbpat103.seq - Patent sequence entries, part 103.
2385. gbpat104.seq - Patent sequence entries, part 104.
2386. gbpat105.seq - Patent sequence entries, part 105.
2387. gbpat106.seq - Patent sequence entries, part 106.
2388. gbpat107.seq - Patent sequence entries, part 107.
2389. gbpat108.seq - Patent sequence entries, part 108.
2390. gbpat109.seq - Patent sequence entries, part 109.
2391. gbpat11.seq - Patent sequence entries, part 11.
2392. gbpat110.seq - Patent sequence entries, part 110.
2393. gbpat12.seq - Patent sequence entries, part 12.
2394. gbpat13.seq - Patent sequence entries, part 13.
2395. gbpat14.seq - Patent sequence entries, part 14.
2396. gbpat15.seq - Patent sequence entries, part 15.
2397. gbpat16.seq - Patent sequence entries, part 16.
2398. gbpat17.seq - Patent sequence entries, part 17.
2399. gbpat18.seq - Patent sequence entries, part 18.
2400. gbpat19.seq - Patent sequence entries, part 19.
2401. gbpat2.seq - Patent sequence entries, part 2.
2402. gbpat20.seq - Patent sequence entries, part 20.
2403. gbpat21.seq - Patent sequence entries, part 21.
2404. gbpat22.seq - Patent sequence entries, part 22.
2405. gbpat23.seq - Patent sequence entries, part 23.
2406. gbpat24.seq - Patent sequence entries, part 24.
2407. gbpat25.seq - Patent sequence entries, part 25.
2408. gbpat26.seq - Patent sequence entries, part 26.
2409. gbpat27.seq - Patent sequence entries, part 27.
2410. gbpat28.seq - Patent sequence entries, part 28.
2411. gbpat29.seq - Patent sequence entries, part 29.
2412. gbpat3.seq - Patent sequence entries, part 3.
2413. gbpat30.seq - Patent sequence entries, part 30.
2414. gbpat31.seq - Patent sequence entries, part 31.
2415. gbpat32.seq - Patent sequence entries, part 32.
2416. gbpat33.seq - Patent sequence entries, part 33.
2417. gbpat34.seq - Patent sequence entries, part 34.
2418. gbpat35.seq - Patent sequence entries, part 35.
2419. gbpat36.seq - Patent sequence entries, part 36.
2420. gbpat37.seq - Patent sequence entries, part 37.
2421. gbpat38.seq - Patent sequence entries, part 38.
2422. gbpat39.seq - Patent sequence entries, part 39.
2423. gbpat4.seq - Patent sequence entries, part 4.
2424. gbpat40.seq - Patent sequence entries, part 40.
2425. gbpat41.seq - Patent sequence entries, part 41.
2426. gbpat42.seq - Patent sequence entries, part 42.
2427. gbpat43.seq - Patent sequence entries, part 43.
2428. gbpat44.seq - Patent sequence entries, part 44.
2429. gbpat45.seq - Patent sequence entries, part 45.
2430. gbpat46.seq - Patent sequence entries, part 46.
2431. gbpat47.seq - Patent sequence entries, part 47.
2432. gbpat48.seq - Patent sequence entries, part 48.
2433. gbpat49.seq - Patent sequence entries, part 49.
2434. gbpat5.seq - Patent sequence entries, part 5.
2435. gbpat50.seq - Patent sequence entries, part 50.
2436. gbpat51.seq - Patent sequence entries, part 51.
2437. gbpat52.seq - Patent sequence entries, part 52.
2438. gbpat53.seq - Patent sequence entries, part 53.
2439. gbpat54.seq - Patent sequence entries, part 54.
2440. gbpat55.seq - Patent sequence entries, part 55.
2441. gbpat56.seq - Patent sequence entries, part 56.
2442. gbpat57.seq - Patent sequence entries, part 57.
2443. gbpat58.seq - Patent sequence entries, part 58.
2444. gbpat59.seq - Patent sequence entries, part 59.
2445. gbpat6.seq - Patent sequence entries, part 6.
2446. gbpat60.seq - Patent sequence entries, part 60.
2447. gbpat61.seq - Patent sequence entries, part 61.
2448. gbpat62.seq - Patent sequence entries, part 62.
2449. gbpat63.seq - Patent sequence entries, part 63.
2450. gbpat64.seq - Patent sequence entries, part 64.
2451. gbpat65.seq - Patent sequence entries, part 65.
2452. gbpat66.seq - Patent sequence entries, part 66.
2453. gbpat67.seq - Patent sequence entries, part 67.
2454. gbpat68.seq - Patent sequence entries, part 68.
2455. gbpat69.seq - Patent sequence entries, part 69.
2456. gbpat7.seq - Patent sequence entries, part 7.
2457. gbpat70.seq - Patent sequence entries, part 70.
2458. gbpat71.seq - Patent sequence entries, part 71.
2459. gbpat72.seq - Patent sequence entries, part 72.
2460. gbpat73.seq - Patent sequence entries, part 73.
2461. gbpat74.seq - Patent sequence entries, part 74.
2462. gbpat75.seq - Patent sequence entries, part 75.
2463. gbpat76.seq - Patent sequence entries, part 76.
2464. gbpat77.seq - Patent sequence entries, part 77.
2465. gbpat78.seq - Patent sequence entries, part 78.
2466. gbpat79.seq - Patent sequence entries, part 79.
2467. gbpat8.seq - Patent sequence entries, part 8.
2468. gbpat80.seq - Patent sequence entries, part 80.
2469. gbpat81.seq - Patent sequence entries, part 81.
2470. gbpat82.seq - Patent sequence entries, part 82.
2471. gbpat83.seq - Patent sequence entries, part 83.
2472. gbpat84.seq - Patent sequence entries, part 84.
2473. gbpat85.seq - Patent sequence entries, part 85.
2474. gbpat86.seq - Patent sequence entries, part 86.
2475. gbpat87.seq - Patent sequence entries, part 87.
2476. gbpat88.seq - Patent sequence entries, part 88.
2477. gbpat89.seq - Patent sequence entries, part 89.
2478. gbpat9.seq - Patent sequence entries, part 9.
2479. gbpat90.seq - Patent sequence entries, part 90.
2480. gbpat91.seq - Patent sequence entries, part 91.
2481. gbpat92.seq - Patent sequence entries, part 92.
2482. gbpat93.seq - Patent sequence entries, part 93.
2483. gbpat94.seq - Patent sequence entries, part 94.
2484. gbpat95.seq - Patent sequence entries, part 95.
2485. gbpat96.seq - Patent sequence entries, part 96.
2486. gbpat97.seq - Patent sequence entries, part 97.
2487. gbpat98.seq - Patent sequence entries, part 98.
2488. gbpat99.seq - Patent sequence entries, part 99.
2489. gbphg1.seq - Phage sequence entries, part 1.
2490. gbphg2.seq - Phage sequence entries, part 2.
2491. gbphg3.seq - Phage sequence entries, part 3.
2492. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2493. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2494. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2495. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
2496. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
2497. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
2498. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
2499. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
2500. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
2501. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
2502. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
2503. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
2504. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
2505. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2506. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
2507. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
2508. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
2509. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
2510. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
2511. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
2512. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
2513. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
2514. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
2515. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
2516. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2517. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
2518. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
2519. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
2520. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
2521. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
2522. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
2523. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
2524. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
2525. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
2526. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
2527. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2528. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
2529. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
2530. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
2531. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
2532. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
2533. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
2534. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
2535. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
2536. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
2537. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
2538. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2539. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
2540. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
2541. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
2542. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
2543. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
2544. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
2545. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
2546. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
2547. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
2548. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
2549. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2550. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
2551. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
2552. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
2553. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
2554. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
2555. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
2556. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
2557. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
2558. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
2559. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
2560. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2561. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
2562. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
2563. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
2564. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
2565. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
2566. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
2567. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
2568. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
2569. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
2570. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
2571. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2572. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
2573. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
2574. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
2575. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
2576. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
2577. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
2578. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
2579. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
2580. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
2581. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
2582. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2583. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
2584. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
2585. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
2586. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
2587. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
2588. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
2589. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
2590. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
2591. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
2592. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
2593. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2594. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
2595. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
2596. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
2597. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
2598. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
2599. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
2600. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
2601. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
2602. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
2603. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
2604. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2605. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2606. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
2607. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
2608. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
2609. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
2610. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
2611. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
2612. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
2613. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
2614. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
2615. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
2616. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2617. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
2618. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
2619. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
2620. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
2621. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
2622. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
2623. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
2624. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
2625. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
2626. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
2627. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2628. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
2629. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
2630. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
2631. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
2632. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
2633. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
2634. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
2635. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
2636. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
2637. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
2638. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2639. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
2640. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
2641. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
2642. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
2643. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
2644. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
2645. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
2646. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
2647. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
2648. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
2649. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2650. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
2651. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
2652. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
2653. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
2654. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
2655. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
2656. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
2657. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
2658. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
2659. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
2660. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2661. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
2662. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
2663. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
2664. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
2665. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
2666. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
2667. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
2668. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
2669. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
2670. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
2671. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2672. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
2673. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
2674. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
2675. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
2676. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
2677. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
2678. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
2679. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
2680. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
2681. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
2682. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2683. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
2684. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
2685. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
2686. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
2687. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
2688. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
2689. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
2690. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
2691. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
2692. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
2693. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2694. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
2695. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
2696. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
2697. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
2698. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
2699. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
2700. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
2701. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
2702. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
2703. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
2704. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2705. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
2706. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
2707. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
2708. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
2709. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
2710. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
2711. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
2712. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
2713. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
2714. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
2715. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2716. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2717. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
2718. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
2719. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
2720. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
2721. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
2722. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
2723. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
2724. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
2725. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
2726. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
2727. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2728. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
2729. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
2730. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
2731. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
2732. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
2733. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
2734. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
2735. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
2736. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
2737. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
2738. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2739. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
2740. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
2741. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
2742. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
2743. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
2744. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
2745. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
2746. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
2747. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
2748. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
2749. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2750. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
2751. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
2752. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
2753. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
2754. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
2755. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
2756. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
2757. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
2758. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
2759. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
2760. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2761. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
2762. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
2763. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
2764. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
2765. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
2766. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
2767. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
2768. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
2769. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
2770. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
2771. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2772. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
2773. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
2774. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
2775. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
2776. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
2777. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
2778. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
2779. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
2780. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
2781. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
2782. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2783. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
2784. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
2785. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
2786. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
2787. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
2788. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
2789. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266.
2790. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267.
2791. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268.
2792. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269.
2793. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2794. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270.
2795. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271.
2796. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272.
2797. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273.
2798. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274.
2799. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275.
2800. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276.
2801. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277.
2802. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278.
2803. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279.
2804. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2805. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280.
2806. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281.
2807. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282.
2808. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283.
2809. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284.
2810. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285.
2811. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286.
2812. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287.
2813. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288.
2814. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289.
2815. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2816. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290.
2817. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291.
2818. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292.
2819. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293.
2820. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294.
2821. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295.
2822. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296.
2823. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297.
2824. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298.
2825. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299.
2826. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2827. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2828. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300.
2829. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301.
2830. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302.
2831. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303.
2832. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304.
2833. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305.
2834. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306.
2835. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307.
2836. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308.
2837. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309.
2838. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2839. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310.
2840. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311.
2841. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312.
2842. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313.
2843. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314.
2844. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315.
2845. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316.
2846. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317.
2847. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318.
2848. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319.
2849. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2850. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320.
2851. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321.
2852. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322.
2853. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323.
2854. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324.
2855. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325.
2856. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326.
2857. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327.
2858. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328.
2859. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329.
2860. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2861. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330.
2862. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331.
2863. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332.
2864. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333.
2865. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334.
2866. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335.
2867. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336.
2868. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337.
2869. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338.
2870. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339.
2871. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2872. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340.
2873. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341.
2874. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342.
2875. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343.
2876. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344.
2877. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345.
2878. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346.
2879. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347.
2880. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348.
2881. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349.
2882. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2883. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350.
2884. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351.
2885. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352.
2886. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353.
2887. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354.
2888. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355.
2889. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356.
2890. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357.
2891. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358.
2892. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359.
2893. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2894. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360.
2895. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361.
2896. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362.
2897. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363.
2898. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364.
2899. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365.
2900. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366.
2901. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367.
2902. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368.
2903. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369.
2904. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2905. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370.
2906. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371.
2907. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372.
2908. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373.
2909. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374.
2910. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375.
2911. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376.
2912. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377.
2913. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378.
2914. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379.
2915. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2916. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380.
2917. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381.
2918. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382.
2919. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383.
2920. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384.
2921. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385.
2922. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386.
2923. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387.
2924. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388.
2925. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389.
2926. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2927. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390.
2928. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391.
2929. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392.
2930. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393.
2931. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394.
2932. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395.
2933. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396.
2934. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397.
2935. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398.
2936. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399.
2937. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2938. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2939. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400.
2940. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401.
2941. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402.
2942. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403.
2943. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404.
2944. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405.
2945. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406.
2946. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407.
2947. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408.
2948. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409.
2949. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2950. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410.
2951. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411.
2952. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412.
2953. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413.
2954. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414.
2955. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415.
2956. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416.
2957. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417.
2958. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418.
2959. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419.
2960. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2961. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420.
2962. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421.
2963. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422.
2964. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423.
2965. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424.
2966. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425.
2967. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426.
2968. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427.
2969. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428.
2970. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429.
2971. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2972. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430.
2973. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431.
2974. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432.
2975. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433.
2976. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434.
2977. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435.
2978. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436.
2979. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437.
2980. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438.
2981. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439.
2982. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2983. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440.
2984. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441.
2985. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442.
2986. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443.
2987. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444.
2988. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445.
2989. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446.
2990. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447.
2991. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448.
2992. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449.
2993. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2994. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450.
2995. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451.
2996. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452.
2997. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453.
2998. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454.
2999. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455.
3000. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456.
3001. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457.
3002. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458.
3003. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459.
3004. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
3005. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460.
3006. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461.
3007. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462.
3008. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463.
3009. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464.
3010. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465.
3011. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466.
3012. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467.
3013. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468.
3014. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469.
3015. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
3016. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470.
3017. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471.
3018. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472.
3019. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473.
3020. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474.
3021. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475.
3022. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476.
3023. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477.
3024. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478.
3025. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479.
3026. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
3027. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480.
3028. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481.
3029. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482.
3030. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483.
3031. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484.
3032. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485.
3033. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486.
3034. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487.
3035. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488.
3036. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489.
3037. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
3038. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490.
3039. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491.
3040. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492.
3041. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493.
3042. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494.
3043. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495.
3044. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496.
3045. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497.
3046. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498.
3047. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499.
3048. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
3049. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
3050. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500.
3051. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501.
3052. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502.
3053. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503.
3054. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504.
3055. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505.
3056. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506.
3057. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507.
3058. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508.
3059. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509.
3060. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
3061. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510.
3062. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511.
3063. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512.
3064. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513.
3065. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514.
3066. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515.
3067. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516.
3068. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517.
3069. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518.
3070. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519.
3071. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
3072. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520.
3073. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521.
3074. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522.
3075. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523.
3076. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524.
3077. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525.
3078. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526.
3079. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527.
3080. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528.
3081. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529.
3082. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
3083. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530.
3084. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531.
3085. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532.
3086. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533.
3087. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534.
3088. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535.
3089. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536.
3090. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537.
3091. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538.
3092. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539.
3093. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
3094. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540.
3095. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541.
3096. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542.
3097. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543.
3098. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544.
3099. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545.
3100. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546.
3101. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547.
3102. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548.
3103. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549.
3104. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
3105. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550.
3106. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551.
3107. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552.
3108. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553.
3109. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554.
3110. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555.
3111. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556.
3112. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557.
3113. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558.
3114. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559.
3115. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
3116. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560.
3117. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561.
3118. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562.
3119. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563.
3120. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564.
3121. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565.
3122. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566.
3123. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567.
3124. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568.
3125. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569.
3126. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
3127. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570.
3128. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571.
3129. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572.
3130. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573.
3131. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574.
3132. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575.
3133. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576.
3134. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577.
3135. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578.
3136. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579.
3137. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
3138. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580.
3139. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581.
3140. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582.
3141. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583.
3142. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584.
3143. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585.
3144. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586.
3145. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587.
3146. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588.
3147. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589.
3148. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
3149. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590.
3150. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591.
3151. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592.
3152. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593.
3153. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594.
3154. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595.
3155. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596.
3156. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597.
3157. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598.
3158. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599.
3159. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
3160. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
3161. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600.
3162. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601.
3163. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602.
3164. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603.
3165. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604.
3166. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605.
3167. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606.
3168. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607.
3169. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608.
3170. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609.
3171. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
3172. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610.
3173. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611.
3174. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612.
3175. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613.
3176. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614.
3177. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615.
3178. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616.
3179. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617.
3180. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618.
3181. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619.
3182. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
3183. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620.
3184. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621.
3185. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622.
3186. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623.
3187. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624.
3188. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625.
3189. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626.
3190. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627.
3191. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628.
3192. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629.
3193. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
3194. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630.
3195. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631.
3196. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632.
3197. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633.
3198. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634.
3199. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635.
3200. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636.
3201. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637.
3202. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638.
3203. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639.
3204. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
3205. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640.
3206. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641.
3207. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642.
3208. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643.
3209. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644.
3210. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645.
3211. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646.
3212. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647.
3213. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648.
3214. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649.
3215. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
3216. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650.
3217. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651.
3218. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652.
3219. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653.
3220. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654.
3221. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655.
3222. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656.
3223. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657.
3224. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658.
3225. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659.
3226. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
3227. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660.
3228. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661.
3229. gbpln1662.seq - Plant sequence entries (including fungi and algae), part 1662.
3230. gbpln1663.seq - Plant sequence entries (including fungi and algae), part 1663.
3231. gbpln1664.seq - Plant sequence entries (including fungi and algae), part 1664.
3232. gbpln1665.seq - Plant sequence entries (including fungi and algae), part 1665.
3233. gbpln1666.seq - Plant sequence entries (including fungi and algae), part 1666.
3234. gbpln1667.seq - Plant sequence entries (including fungi and algae), part 1667.
3235. gbpln1668.seq - Plant sequence entries (including fungi and algae), part 1668.
3236. gbpln1669.seq - Plant sequence entries (including fungi and algae), part 1669.
3237. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
3238. gbpln1670.seq - Plant sequence entries (including fungi and algae), part 1670.
3239. gbpln1671.seq - Plant sequence entries (including fungi and algae), part 1671.
3240. gbpln1672.seq - Plant sequence entries (including fungi and algae), part 1672.
3241. gbpln1673.seq - Plant sequence entries (including fungi and algae), part 1673.
3242. gbpln1674.seq - Plant sequence entries (including fungi and algae), part 1674.
3243. gbpln1675.seq - Plant sequence entries (including fungi and algae), part 1675.
3244. gbpln1676.seq - Plant sequence entries (including fungi and algae), part 1676.
3245. gbpln1677.seq - Plant sequence entries (including fungi and algae), part 1677.
3246. gbpln1678.seq - Plant sequence entries (including fungi and algae), part 1678.
3247. gbpln1679.seq - Plant sequence entries (including fungi and algae), part 1679.
3248. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
3249. gbpln1680.seq - Plant sequence entries (including fungi and algae), part 1680.
3250. gbpln1681.seq - Plant sequence entries (including fungi and algae), part 1681.
3251. gbpln1682.seq - Plant sequence entries (including fungi and algae), part 1682.
3252. gbpln1683.seq - Plant sequence entries (including fungi and algae), part 1683.
3253. gbpln1684.seq - Plant sequence entries (including fungi and algae), part 1684.
3254. gbpln1685.seq - Plant sequence entries (including fungi and algae), part 1685.
3255. gbpln1686.seq - Plant sequence entries (including fungi and algae), part 1686.
3256. gbpln1687.seq - Plant sequence entries (including fungi and algae), part 1687.
3257. gbpln1688.seq - Plant sequence entries (including fungi and algae), part 1688.
3258. gbpln1689.seq - Plant sequence entries (including fungi and algae), part 1689.
3259. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
3260. gbpln1690.seq - Plant sequence entries (including fungi and algae), part 1690.
3261. gbpln1691.seq - Plant sequence entries (including fungi and algae), part 1691.
3262. gbpln1692.seq - Plant sequence entries (including fungi and algae), part 1692.
3263. gbpln1693.seq - Plant sequence entries (including fungi and algae), part 1693.
3264. gbpln1694.seq - Plant sequence entries (including fungi and algae), part 1694.
3265. gbpln1695.seq - Plant sequence entries (including fungi and algae), part 1695.
3266. gbpln1696.seq - Plant sequence entries (including fungi and algae), part 1696.
3267. gbpln1697.seq - Plant sequence entries (including fungi and algae), part 1697.
3268. gbpln1698.seq - Plant sequence entries (including fungi and algae), part 1698.
3269. gbpln1699.seq - Plant sequence entries (including fungi and algae), part 1699.
3270. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
3271. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
3272. gbpln1700.seq - Plant sequence entries (including fungi and algae), part 1700.
3273. gbpln1701.seq - Plant sequence entries (including fungi and algae), part 1701.
3274. gbpln1702.seq - Plant sequence entries (including fungi and algae), part 1702.
3275. gbpln1703.seq - Plant sequence entries (including fungi and algae), part 1703.
3276. gbpln1704.seq - Plant sequence entries (including fungi and algae), part 1704.
3277. gbpln1705.seq - Plant sequence entries (including fungi and algae), part 1705.
3278. gbpln1706.seq - Plant sequence entries (including fungi and algae), part 1706.
3279. gbpln1707.seq - Plant sequence entries (including fungi and algae), part 1707.
3280. gbpln1708.seq - Plant sequence entries (including fungi and algae), part 1708.
3281. gbpln1709.seq - Plant sequence entries (including fungi and algae), part 1709.
3282. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
3283. gbpln1710.seq - Plant sequence entries (including fungi and algae), part 1710.
3284. gbpln1711.seq - Plant sequence entries (including fungi and algae), part 1711.
3285. gbpln1712.seq - Plant sequence entries (including fungi and algae), part 1712.
3286. gbpln1713.seq - Plant sequence entries (including fungi and algae), part 1713.
3287. gbpln1714.seq - Plant sequence entries (including fungi and algae), part 1714.
3288. gbpln1715.seq - Plant sequence entries (including fungi and algae), part 1715.
3289. gbpln1716.seq - Plant sequence entries (including fungi and algae), part 1716.
3290. gbpln1717.seq - Plant sequence entries (including fungi and algae), part 1717.
3291. gbpln1718.seq - Plant sequence entries (including fungi and algae), part 1718.
3292. gbpln1719.seq - Plant sequence entries (including fungi and algae), part 1719.
3293. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
3294. gbpln1720.seq - Plant sequence entries (including fungi and algae), part 1720.
3295. gbpln1721.seq - Plant sequence entries (including fungi and algae), part 1721.
3296. gbpln1722.seq - Plant sequence entries (including fungi and algae), part 1722.
3297. gbpln1723.seq - Plant sequence entries (including fungi and algae), part 1723.
3298. gbpln1724.seq - Plant sequence entries (including fungi and algae), part 1724.
3299. gbpln1725.seq - Plant sequence entries (including fungi and algae), part 1725.
3300. gbpln1726.seq - Plant sequence entries (including fungi and algae), part 1726.
3301. gbpln1727.seq - Plant sequence entries (including fungi and algae), part 1727.
3302. gbpln1728.seq - Plant sequence entries (including fungi and algae), part 1728.
3303. gbpln1729.seq - Plant sequence entries (including fungi and algae), part 1729.
3304. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
3305. gbpln1730.seq - Plant sequence entries (including fungi and algae), part 1730.
3306. gbpln1731.seq - Plant sequence entries (including fungi and algae), part 1731.
3307. gbpln1732.seq - Plant sequence entries (including fungi and algae), part 1732.
3308. gbpln1733.seq - Plant sequence entries (including fungi and algae), part 1733.
3309. gbpln1734.seq - Plant sequence entries (including fungi and algae), part 1734.
3310. gbpln1735.seq - Plant sequence entries (including fungi and algae), part 1735.
3311. gbpln1736.seq - Plant sequence entries (including fungi and algae), part 1736.
3312. gbpln1737.seq - Plant sequence entries (including fungi and algae), part 1737.
3313. gbpln1738.seq - Plant sequence entries (including fungi and algae), part 1738.
3314. gbpln1739.seq - Plant sequence entries (including fungi and algae), part 1739.
3315. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
3316. gbpln1740.seq - Plant sequence entries (including fungi and algae), part 1740.
3317. gbpln1741.seq - Plant sequence entries (including fungi and algae), part 1741.
3318. gbpln1742.seq - Plant sequence entries (including fungi and algae), part 1742.
3319. gbpln1743.seq - Plant sequence entries (including fungi and algae), part 1743.
3320. gbpln1744.seq - Plant sequence entries (including fungi and algae), part 1744.
3321. gbpln1745.seq - Plant sequence entries (including fungi and algae), part 1745.
3322. gbpln1746.seq - Plant sequence entries (including fungi and algae), part 1746.
3323. gbpln1747.seq - Plant sequence entries (including fungi and algae), part 1747.
3324. gbpln1748.seq - Plant sequence entries (including fungi and algae), part 1748.
3325. gbpln1749.seq - Plant sequence entries (including fungi and algae), part 1749.
3326. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
3327. gbpln1750.seq - Plant sequence entries (including fungi and algae), part 1750.
3328. gbpln1751.seq - Plant sequence entries (including fungi and algae), part 1751.
3329. gbpln1752.seq - Plant sequence entries (including fungi and algae), part 1752.
3330. gbpln1753.seq - Plant sequence entries (including fungi and algae), part 1753.
3331. gbpln1754.seq - Plant sequence entries (including fungi and algae), part 1754.
3332. gbpln1755.seq - Plant sequence entries (including fungi and algae), part 1755.
3333. gbpln1756.seq - Plant sequence entries (including fungi and algae), part 1756.
3334. gbpln1757.seq - Plant sequence entries (including fungi and algae), part 1757.
3335. gbpln1758.seq - Plant sequence entries (including fungi and algae), part 1758.
3336. gbpln1759.seq - Plant sequence entries (including fungi and algae), part 1759.
3337. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
3338. gbpln1760.seq - Plant sequence entries (including fungi and algae), part 1760.
3339. gbpln1761.seq - Plant sequence entries (including fungi and algae), part 1761.
3340. gbpln1762.seq - Plant sequence entries (including fungi and algae), part 1762.
3341. gbpln1763.seq - Plant sequence entries (including fungi and algae), part 1763.
3342. gbpln1764.seq - Plant sequence entries (including fungi and algae), part 1764.
3343. gbpln1765.seq - Plant sequence entries (including fungi and algae), part 1765.
3344. gbpln1766.seq - Plant sequence entries (including fungi and algae), part 1766.
3345. gbpln1767.seq - Plant sequence entries (including fungi and algae), part 1767.
3346. gbpln1768.seq - Plant sequence entries (including fungi and algae), part 1768.
3347. gbpln1769.seq - Plant sequence entries (including fungi and algae), part 1769.
3348. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
3349. gbpln1770.seq - Plant sequence entries (including fungi and algae), part 1770.
3350. gbpln1771.seq - Plant sequence entries (including fungi and algae), part 1771.
3351. gbpln1772.seq - Plant sequence entries (including fungi and algae), part 1772.
3352. gbpln1773.seq - Plant sequence entries (including fungi and algae), part 1773.
3353. gbpln1774.seq - Plant sequence entries (including fungi and algae), part 1774.
3354. gbpln1775.seq - Plant sequence entries (including fungi and algae), part 1775.
3355. gbpln1776.seq - Plant sequence entries (including fungi and algae), part 1776.
3356. gbpln1777.seq - Plant sequence entries (including fungi and algae), part 1777.
3357. gbpln1778.seq - Plant sequence entries (including fungi and algae), part 1778.
3358. gbpln1779.seq - Plant sequence entries (including fungi and algae), part 1779.
3359. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
3360. gbpln1780.seq - Plant sequence entries (including fungi and algae), part 1780.
3361. gbpln1781.seq - Plant sequence entries (including fungi and algae), part 1781.
3362. gbpln1782.seq - Plant sequence entries (including fungi and algae), part 1782.
3363. gbpln1783.seq - Plant sequence entries (including fungi and algae), part 1783.
3364. gbpln1784.seq - Plant sequence entries (including fungi and algae), part 1784.
3365. gbpln1785.seq - Plant sequence entries (including fungi and algae), part 1785.
3366. gbpln1786.seq - Plant sequence entries (including fungi and algae), part 1786.
3367. gbpln1787.seq - Plant sequence entries (including fungi and algae), part 1787.
3368. gbpln1788.seq - Plant sequence entries (including fungi and algae), part 1788.
3369. gbpln1789.seq - Plant sequence entries (including fungi and algae), part 1789.
3370. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
3371. gbpln1790.seq - Plant sequence entries (including fungi and algae), part 1790.
3372. gbpln1791.seq - Plant sequence entries (including fungi and algae), part 1791.
3373. gbpln1792.seq - Plant sequence entries (including fungi and algae), part 1792.
3374. gbpln1793.seq - Plant sequence entries (including fungi and algae), part 1793.
3375. gbpln1794.seq - Plant sequence entries (including fungi and algae), part 1794.
3376. gbpln1795.seq - Plant sequence entries (including fungi and algae), part 1795.
3377. gbpln1796.seq - Plant sequence entries (including fungi and algae), part 1796.
3378. gbpln1797.seq - Plant sequence entries (including fungi and algae), part 1797.
3379. gbpln1798.seq - Plant sequence entries (including fungi and algae), part 1798.
3380. gbpln1799.seq - Plant sequence entries (including fungi and algae), part 1799.
3381. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
3382. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
3383. gbpln1800.seq - Plant sequence entries (including fungi and algae), part 1800.
3384. gbpln1801.seq - Plant sequence entries (including fungi and algae), part 1801.
3385. gbpln1802.seq - Plant sequence entries (including fungi and algae), part 1802.
3386. gbpln1803.seq - Plant sequence entries (including fungi and algae), part 1803.
3387. gbpln1804.seq - Plant sequence entries (including fungi and algae), part 1804.
3388. gbpln1805.seq - Plant sequence entries (including fungi and algae), part 1805.
3389. gbpln1806.seq - Plant sequence entries (including fungi and algae), part 1806.
3390. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
3391. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
3392. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
3393. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
3394. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
3395. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
3396. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
3397. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
3398. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
3399. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
3400. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
3401. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
3402. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
3403. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
3404. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
3405. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
3406. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
3407. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
3408. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
3409. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
3410. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
3411. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
3412. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
3413. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
3414. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
3415. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
3416. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
3417. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
3418. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
3419. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
3420. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
3421. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
3422. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
3423. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
3424. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
3425. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
3426. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
3427. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
3428. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
3429. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
3430. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
3431. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
3432. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
3433. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
3434. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
3435. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
3436. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
3437. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
3438. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
3439. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
3440. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
3441. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
3442. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
3443. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
3444. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
3445. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
3446. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
3447. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
3448. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
3449. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
3450. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
3451. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
3452. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
3453. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
3454. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
3455. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
3456. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
3457. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
3458. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
3459. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
3460. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
3461. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
3462. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
3463. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
3464. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
3465. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
3466. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
3467. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
3468. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
3469. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
3470. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
3471. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
3472. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
3473. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
3474. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
3475. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
3476. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
3477. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
3478. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
3479. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
3480. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
3481. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
3482. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
3483. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
3484. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
3485. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
3486. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
3487. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
3488. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
3489. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
3490. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
3491. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
3492. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
3493. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
3494. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
3495. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
3496. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
3497. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
3498. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
3499. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
3500. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
3501. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
3502. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
3503. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
3504. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
3505. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
3506. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
3507. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
3508. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
3509. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
3510. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
3511. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
3512. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
3513. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
3514. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
3515. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
3516. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
3517. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
3518. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
3519. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
3520. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
3521. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
3522. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
3523. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
3524. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
3525. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
3526. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
3527. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
3528. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
3529. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
3530. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
3531. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
3532. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
3533. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
3534. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
3535. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
3536. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
3537. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
3538. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
3539. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
3540. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
3541. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
3542. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
3543. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
3544. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
3545. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
3546. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
3547. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
3548. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
3549. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
3550. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
3551. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
3552. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
3553. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
3554. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
3555. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
3556. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
3557. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
3558. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
3559. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
3560. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
3561. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
3562. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
3563. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
3564. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
3565. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
3566. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
3567. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
3568. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
3569. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
3570. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
3571. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
3572. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
3573. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
3574. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
3575. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
3576. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
3577. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
3578. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
3579. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
3580. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
3581. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
3582. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
3583. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
3584. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
3585. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
3586. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
3587. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
3588. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
3589. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
3590. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
3591. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
3592. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
3593. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
3594. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
3595. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
3596. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
3597. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
3598. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
3599. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
3600. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
3601. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
3602. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
3603. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
3604. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
3605. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
3606. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
3607. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
3608. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
3609. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
3610. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
3611. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
3612. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
3613. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
3614. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
3615. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
3616. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
3617. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
3618. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
3619. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
3620. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
3621. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
3622. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
3623. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
3624. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
3625. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
3626. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
3627. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
3628. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
3629. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
3630. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
3631. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
3632. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
3633. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
3634. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
3635. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
3636. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
3637. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
3638. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
3639. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
3640. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
3641. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
3642. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
3643. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
3644. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
3645. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
3646. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
3647. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
3648. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
3649. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
3650. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
3651. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
3652. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
3653. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
3654. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
3655. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
3656. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
3657. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
3658. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
3659. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
3660. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
3661. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
3662. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
3663. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
3664. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
3665. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
3666. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
3667. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
3668. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
3669. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
3670. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
3671. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
3672. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
3673. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
3674. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
3675. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
3676. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
3677. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
3678. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
3679. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
3680. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
3681. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
3682. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
3683. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
3684. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
3685. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
3686. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
3687. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
3688. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
3689. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
3690. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
3691. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
3692. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
3693. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
3694. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
3695. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
3696. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
3697. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
3698. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
3699. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
3700. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
3701. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3702. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3703. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3704. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3705. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3706. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3707. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3708. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3709. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3710. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3711. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3712. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3713. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3714. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3715. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3716. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3717. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3718. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3719. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3720. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3721. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3722. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3723. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3724. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3725. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3726. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3727. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3728. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3729. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3730. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3731. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3732. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3733. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3734. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3735. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3736. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3737. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3738. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3739. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3740. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3741. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3742. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3743. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3744. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3745. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3746. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3747. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3748. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3749. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3750. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3751. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3752. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3753. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3754. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3755. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3756. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3757. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3758. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3759. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3760. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3761. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3762. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3763. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3764. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3765. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3766. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3767. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3768. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3769. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3770. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3771. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3772. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3773. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3774. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3775. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3776. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3777. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3778. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3779. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3780. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3781. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3782. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3783. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3784. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3785. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3786. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3787. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3788. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3789. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3790. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3791. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3792. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3793. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3794. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3795. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3796. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3797. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3798. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3799. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3800. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3801. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3802. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3803. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3804. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3805. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3806. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3807. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3808. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3809. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3810. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3811. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3812. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3813. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3814. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3815. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3816. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3817. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3818. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3819. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3820. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3821. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3822. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3823. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3824. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3825. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3826. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3827. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3828. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3829. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3830. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3831. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3832. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3833. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3834. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3835. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3836. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3837. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3838. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3839. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3840. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3841. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3842. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3843. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3844. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3845. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3846. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3847. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3848. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3849. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3850. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3851. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3852. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3853. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3854. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3855. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3856. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3857. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3858. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3859. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3860. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3861. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3862. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3863. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3864. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3865. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3866. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3867. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3868. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3869. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3870. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3871. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3872. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3873. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3874. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3875. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3876. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3877. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3878. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3879. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3880. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3881. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3882. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3883. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3884. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3885. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3886. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3887. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3888. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3889. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3890. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3891. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3892. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3893. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3894. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3895. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3896. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3897. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3898. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3899. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3900. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3901. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3902. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3903. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3904. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3905. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3906. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3907. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3908. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3909. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3910. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3911. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3912. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3913. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3914. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3915. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3916. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3917. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3918. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3919. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3920. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3921. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3922. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3923. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3924. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3925. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3926. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3927. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3928. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3929. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3930. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3931. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3932. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3933. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3934. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3935. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3936. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3937. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3938. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3939. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3940. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3941. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3942. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3943. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3944. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3945. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3946. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3947. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3948. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3949. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3950. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3951. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3952. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3953. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3954. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3955. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3956. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3957. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3958. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3959. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3960. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3961. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3962. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3963. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3964. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3965. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3966. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3967. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3968. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3969. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3970. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3971. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3972. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3973. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3974. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3975. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3976. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3977. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3978. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3979. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3980. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3981. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3982. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3983. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3984. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3985. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3986. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3987. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3988. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3989. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3990. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3991. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3992. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3993. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
3994. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
3995. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
3996. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
3997. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
3998. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
3999. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
4000. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
4001. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
4002. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
4003. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
4004. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
4005. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
4006. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
4007. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
4008. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
4009. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
4010. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
4011. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
4012. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
4013. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
4014. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
4015. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
4016. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
4017. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
4018. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
4019. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
4020. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
4021. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
4022. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
4023. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
4024. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
4025. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
4026. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
4027. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
4028. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
4029. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
4030. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
4031. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
4032. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
4033. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
4034. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
4035. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
4036. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
4037. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
4038. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
4039. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
4040. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
4041. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
4042. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
4043. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
4044. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
4045. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
4046. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
4047. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
4048. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
4049. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
4050. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
4051. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
4052. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
4053. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
4054. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
4055. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
4056. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
4057. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
4058. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
4059. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
4060. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
4061. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
4062. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
4063. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
4064. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
4065. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
4066. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
4067. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
4068. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
4069. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
4070. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
4071. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
4072. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
4073. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
4074. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
4075. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
4076. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
4077. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
4078. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
4079. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
4080. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
4081. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
4082. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
4083. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
4084. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
4085. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
4086. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
4087. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
4088. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
4089. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
4090. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
4091. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
4092. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
4093. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
4094. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
4095. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
4096. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
4097. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
4098. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
4099. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
4100. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
4101. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
4102. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
4103. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
4104. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
4105. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
4106. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
4107. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
4108. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
4109. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
4110. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
4111. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
4112. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
4113. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
4114. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
4115. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
4116. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
4117. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
4118. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
4119. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
4120. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
4121. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
4122. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
4123. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
4124. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
4125. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
4126. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
4127. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
4128. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
4129. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
4130. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
4131. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
4132. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
4133. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
4134. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
4135. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
4136. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
4137. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
4138. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
4139. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
4140. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
4141. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
4142. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
4143. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
4144. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
4145. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
4146. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
4147. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
4148. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
4149. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
4150. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
4151. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
4152. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
4153. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
4154. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
4155. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
4156. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
4157. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
4158. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
4159. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
4160. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
4161. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
4162. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
4163. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
4164. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
4165. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
4166. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
4167. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
4168. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
4169. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
4170. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
4171. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
4172. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
4173. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
4174. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
4175. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
4176. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
4177. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
4178. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
4179. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
4180. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
4181. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
4182. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
4183. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
4184. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
4185. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
4186. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
4187. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
4188. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
4189. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
4190. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
4191. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
4192. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
4193. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
4194. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
4195. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
4196. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
4197. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
4198. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
4199. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
4200. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
4201. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
4202. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
4203. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
4204. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
4205. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
4206. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
4207. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
4208. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
4209. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
4210. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
4211. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
4212. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
4213. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
4214. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
4215. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
4216. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
4217. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
4218. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
4219. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
4220. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
4221. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
4222. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
4223. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
4224. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
4225. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
4226. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
4227. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
4228. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
4229. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
4230. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
4231. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
4232. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
4233. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
4234. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
4235. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
4236. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
4237. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
4238. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
4239. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
4240. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
4241. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
4242. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
4243. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
4244. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
4245. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
4246. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
4247. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
4248. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
4249. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
4250. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
4251. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
4252. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
4253. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
4254. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
4255. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
4256. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
4257. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
4258. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
4259. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
4260. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
4261. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
4262. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
4263. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
4264. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
4265. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
4266. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
4267. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
4268. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
4269. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
4270. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
4271. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
4272. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
4273. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
4274. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
4275. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
4276. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
4277. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
4278. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
4279. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
4280. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
4281. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
4282. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
4283. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
4284. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
4285. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
4286. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
4287. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
4288. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
4289. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
4290. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
4291. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
4292. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
4293. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
4294. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
4295. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
4296. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
4297. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
4298. gbpri1.seq - Primate sequence entries, part 1.
4299. gbpri10.seq - Primate sequence entries, part 10.
4300. gbpri11.seq - Primate sequence entries, part 11.
4301. gbpri12.seq - Primate sequence entries, part 12.
4302. gbpri13.seq - Primate sequence entries, part 13.
4303. gbpri14.seq - Primate sequence entries, part 14.
4304. gbpri15.seq - Primate sequence entries, part 15.
4305. gbpri16.seq - Primate sequence entries, part 16.
4306. gbpri17.seq - Primate sequence entries, part 17.
4307. gbpri18.seq - Primate sequence entries, part 18.
4308. gbpri19.seq - Primate sequence entries, part 19.
4309. gbpri2.seq - Primate sequence entries, part 2.
4310. gbpri20.seq - Primate sequence entries, part 20.
4311. gbpri21.seq - Primate sequence entries, part 21.
4312. gbpri22.seq - Primate sequence entries, part 22.
4313. gbpri23.seq - Primate sequence entries, part 23.
4314. gbpri24.seq - Primate sequence entries, part 24.
4315. gbpri25.seq - Primate sequence entries, part 25.
4316. gbpri26.seq - Primate sequence entries, part 26.
4317. gbpri27.seq - Primate sequence entries, part 27.
4318. gbpri28.seq - Primate sequence entries, part 28.
4319. gbpri29.seq - Primate sequence entries, part 29.
4320. gbpri3.seq - Primate sequence entries, part 3.
4321. gbpri30.seq - Primate sequence entries, part 30.
4322. gbpri31.seq - Primate sequence entries, part 31.
4323. gbpri32.seq - Primate sequence entries, part 32.
4324. gbpri33.seq - Primate sequence entries, part 33.
4325. gbpri34.seq - Primate sequence entries, part 34.
4326. gbpri35.seq - Primate sequence entries, part 35.
4327. gbpri4.seq - Primate sequence entries, part 4.
4328. gbpri5.seq - Primate sequence entries, part 5.
4329. gbpri6.seq - Primate sequence entries, part 6.
4330. gbpri7.seq - Primate sequence entries, part 7.
4331. gbpri8.seq - Primate sequence entries, part 8.
4332. gbpri9.seq - Primate sequence entries, part 9.
4333. gbrel.txt - Release notes (this document).
4334. gbrod1.seq - Rodent sequence entries, part 1.
4335. gbrod10.seq - Rodent sequence entries, part 10.
4336. gbrod100.seq - Rodent sequence entries, part 100.
4337. gbrod101.seq - Rodent sequence entries, part 101.
4338. gbrod102.seq - Rodent sequence entries, part 102.
4339. gbrod103.seq - Rodent sequence entries, part 103.
4340. gbrod104.seq - Rodent sequence entries, part 104.
4341. gbrod105.seq - Rodent sequence entries, part 105.
4342. gbrod106.seq - Rodent sequence entries, part 106.
4343. gbrod107.seq - Rodent sequence entries, part 107.
4344. gbrod108.seq - Rodent sequence entries, part 108.
4345. gbrod109.seq - Rodent sequence entries, part 109.
4346. gbrod11.seq - Rodent sequence entries, part 11.
4347. gbrod110.seq - Rodent sequence entries, part 110.
4348. gbrod111.seq - Rodent sequence entries, part 111.
4349. gbrod112.seq - Rodent sequence entries, part 112.
4350. gbrod113.seq - Rodent sequence entries, part 113.
4351. gbrod114.seq - Rodent sequence entries, part 114.
4352. gbrod115.seq - Rodent sequence entries, part 115.
4353. gbrod116.seq - Rodent sequence entries, part 116.
4354. gbrod117.seq - Rodent sequence entries, part 117.
4355. gbrod118.seq - Rodent sequence entries, part 118.
4356. gbrod119.seq - Rodent sequence entries, part 119.
4357. gbrod12.seq - Rodent sequence entries, part 12.
4358. gbrod120.seq - Rodent sequence entries, part 120.
4359. gbrod121.seq - Rodent sequence entries, part 121.
4360. gbrod122.seq - Rodent sequence entries, part 122.
4361. gbrod123.seq - Rodent sequence entries, part 123.
4362. gbrod124.seq - Rodent sequence entries, part 124.
4363. gbrod125.seq - Rodent sequence entries, part 125.
4364. gbrod126.seq - Rodent sequence entries, part 126.
4365. gbrod127.seq - Rodent sequence entries, part 127.
4366. gbrod128.seq - Rodent sequence entries, part 128.
4367. gbrod129.seq - Rodent sequence entries, part 129.
4368. gbrod13.seq - Rodent sequence entries, part 13.
4369. gbrod130.seq - Rodent sequence entries, part 130.
4370. gbrod131.seq - Rodent sequence entries, part 131.
4371. gbrod14.seq - Rodent sequence entries, part 14.
4372. gbrod15.seq - Rodent sequence entries, part 15.
4373. gbrod16.seq - Rodent sequence entries, part 16.
4374. gbrod17.seq - Rodent sequence entries, part 17.
4375. gbrod18.seq - Rodent sequence entries, part 18.
4376. gbrod19.seq - Rodent sequence entries, part 19.
4377. gbrod2.seq - Rodent sequence entries, part 2.
4378. gbrod20.seq - Rodent sequence entries, part 20.
4379. gbrod21.seq - Rodent sequence entries, part 21.
4380. gbrod22.seq - Rodent sequence entries, part 22.
4381. gbrod23.seq - Rodent sequence entries, part 23.
4382. gbrod24.seq - Rodent sequence entries, part 24.
4383. gbrod25.seq - Rodent sequence entries, part 25.
4384. gbrod26.seq - Rodent sequence entries, part 26.
4385. gbrod27.seq - Rodent sequence entries, part 27.
4386. gbrod28.seq - Rodent sequence entries, part 28.
4387. gbrod29.seq - Rodent sequence entries, part 29.
4388. gbrod3.seq - Rodent sequence entries, part 3.
4389. gbrod30.seq - Rodent sequence entries, part 30.
4390. gbrod31.seq - Rodent sequence entries, part 31.
4391. gbrod32.seq - Rodent sequence entries, part 32.
4392. gbrod33.seq - Rodent sequence entries, part 33.
4393. gbrod34.seq - Rodent sequence entries, part 34.
4394. gbrod35.seq - Rodent sequence entries, part 35.
4395. gbrod36.seq - Rodent sequence entries, part 36.
4396. gbrod37.seq - Rodent sequence entries, part 37.
4397. gbrod38.seq - Rodent sequence entries, part 38.
4398. gbrod39.seq - Rodent sequence entries, part 39.
4399. gbrod4.seq - Rodent sequence entries, part 4.
4400. gbrod40.seq - Rodent sequence entries, part 40.
4401. gbrod41.seq - Rodent sequence entries, part 41.
4402. gbrod42.seq - Rodent sequence entries, part 42.
4403. gbrod43.seq - Rodent sequence entries, part 43.
4404. gbrod44.seq - Rodent sequence entries, part 44.
4405. gbrod45.seq - Rodent sequence entries, part 45.
4406. gbrod46.seq - Rodent sequence entries, part 46.
4407. gbrod47.seq - Rodent sequence entries, part 47.
4408. gbrod48.seq - Rodent sequence entries, part 48.
4409. gbrod49.seq - Rodent sequence entries, part 49.
4410. gbrod5.seq - Rodent sequence entries, part 5.
4411. gbrod50.seq - Rodent sequence entries, part 50.
4412. gbrod51.seq - Rodent sequence entries, part 51.
4413. gbrod52.seq - Rodent sequence entries, part 52.
4414. gbrod53.seq - Rodent sequence entries, part 53.
4415. gbrod54.seq - Rodent sequence entries, part 54.
4416. gbrod55.seq - Rodent sequence entries, part 55.
4417. gbrod56.seq - Rodent sequence entries, part 56.
4418. gbrod57.seq - Rodent sequence entries, part 57.
4419. gbrod58.seq - Rodent sequence entries, part 58.
4420. gbrod59.seq - Rodent sequence entries, part 59.
4421. gbrod6.seq - Rodent sequence entries, part 6.
4422. gbrod60.seq - Rodent sequence entries, part 60.
4423. gbrod61.seq - Rodent sequence entries, part 61.
4424. gbrod62.seq - Rodent sequence entries, part 62.
4425. gbrod63.seq - Rodent sequence entries, part 63.
4426. gbrod64.seq - Rodent sequence entries, part 64.
4427. gbrod65.seq - Rodent sequence entries, part 65.
4428. gbrod66.seq - Rodent sequence entries, part 66.
4429. gbrod67.seq - Rodent sequence entries, part 67.
4430. gbrod68.seq - Rodent sequence entries, part 68.
4431. gbrod69.seq - Rodent sequence entries, part 69.
4432. gbrod7.seq - Rodent sequence entries, part 7.
4433. gbrod70.seq - Rodent sequence entries, part 70.
4434. gbrod71.seq - Rodent sequence entries, part 71.
4435. gbrod72.seq - Rodent sequence entries, part 72.
4436. gbrod73.seq - Rodent sequence entries, part 73.
4437. gbrod74.seq - Rodent sequence entries, part 74.
4438. gbrod75.seq - Rodent sequence entries, part 75.
4439. gbrod76.seq - Rodent sequence entries, part 76.
4440. gbrod77.seq - Rodent sequence entries, part 77.
4441. gbrod78.seq - Rodent sequence entries, part 78.
4442. gbrod79.seq - Rodent sequence entries, part 79.
4443. gbrod8.seq - Rodent sequence entries, part 8.
4444. gbrod80.seq - Rodent sequence entries, part 80.
4445. gbrod81.seq - Rodent sequence entries, part 81.
4446. gbrod82.seq - Rodent sequence entries, part 82.
4447. gbrod83.seq - Rodent sequence entries, part 83.
4448. gbrod84.seq - Rodent sequence entries, part 84.
4449. gbrod85.seq - Rodent sequence entries, part 85.
4450. gbrod86.seq - Rodent sequence entries, part 86.
4451. gbrod87.seq - Rodent sequence entries, part 87.
4452. gbrod88.seq - Rodent sequence entries, part 88.
4453. gbrod89.seq - Rodent sequence entries, part 89.
4454. gbrod9.seq - Rodent sequence entries, part 9.
4455. gbrod90.seq - Rodent sequence entries, part 90.
4456. gbrod91.seq - Rodent sequence entries, part 91.
4457. gbrod92.seq - Rodent sequence entries, part 92.
4458. gbrod93.seq - Rodent sequence entries, part 93.
4459. gbrod94.seq - Rodent sequence entries, part 94.
4460. gbrod95.seq - Rodent sequence entries, part 95.
4461. gbrod96.seq - Rodent sequence entries, part 96.
4462. gbrod97.seq - Rodent sequence entries, part 97.
4463. gbrod98.seq - Rodent sequence entries, part 98.
4464. gbrod99.seq - Rodent sequence entries, part 99.
4465. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
4466. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
4467. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
4468. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
4469. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
4470. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
4471. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
4472. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
4473. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
4474. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
4475. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
4476. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
4477. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
4478. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
4479. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
4480. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
4481. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
4482. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
4483. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
4484. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
4485. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
4486. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
4487. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
4488. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
4489. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
4490. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
4491. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
4492. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
4493. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
4494. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
4495. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
4496. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
4497. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
4498. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
4499. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
4500. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
4501. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
4502. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
4503. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
4504. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
4505. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
4506. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
4507. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
4508. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
4509. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
4510. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
4511. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
4512. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
4513. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
4514. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
4515. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
4516. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
4517. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
4518. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
4519. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
4520. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
4521. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
4522. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
4523. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
4524. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
4525. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
4526. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
4527. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
4528. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
4529. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
4530. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
4531. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
4532. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
4533. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
4534. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
4535. gbuna1.seq - Unannotated sequence entries, part 1.
4536. gbvrl1.seq - Viral sequence entries, part 1.
4537. gbvrl10.seq - Viral sequence entries, part 10.
4538. gbvrl100.seq - Viral sequence entries, part 100.
4539. gbvrl101.seq - Viral sequence entries, part 101.
4540. gbvrl102.seq - Viral sequence entries, part 102.
4541. gbvrl103.seq - Viral sequence entries, part 103.
4542. gbvrl104.seq - Viral sequence entries, part 104.
4543. gbvrl105.seq - Viral sequence entries, part 105.
4544. gbvrl106.seq - Viral sequence entries, part 106.
4545. gbvrl107.seq - Viral sequence entries, part 107.
4546. gbvrl108.seq - Viral sequence entries, part 108.
4547. gbvrl109.seq - Viral sequence entries, part 109.
4548. gbvrl11.seq - Viral sequence entries, part 11.
4549. gbvrl110.seq - Viral sequence entries, part 110.
4550. gbvrl111.seq - Viral sequence entries, part 111.
4551. gbvrl112.seq - Viral sequence entries, part 112.
4552. gbvrl113.seq - Viral sequence entries, part 113.
4553. gbvrl114.seq - Viral sequence entries, part 114.
4554. gbvrl115.seq - Viral sequence entries, part 115.
4555. gbvrl116.seq - Viral sequence entries, part 116.
4556. gbvrl117.seq - Viral sequence entries, part 117.
4557. gbvrl118.seq - Viral sequence entries, part 118.
4558. gbvrl119.seq - Viral sequence entries, part 119.
4559. gbvrl12.seq - Viral sequence entries, part 12.
4560. gbvrl120.seq - Viral sequence entries, part 120.
4561. gbvrl121.seq - Viral sequence entries, part 121.
4562. gbvrl122.seq - Viral sequence entries, part 122.
4563. gbvrl123.seq - Viral sequence entries, part 123.
4564. gbvrl124.seq - Viral sequence entries, part 124.
4565. gbvrl125.seq - Viral sequence entries, part 125.
4566. gbvrl126.seq - Viral sequence entries, part 126.
4567. gbvrl127.seq - Viral sequence entries, part 127.
4568. gbvrl128.seq - Viral sequence entries, part 128.
4569. gbvrl129.seq - Viral sequence entries, part 129.
4570. gbvrl13.seq - Viral sequence entries, part 13.
4571. gbvrl130.seq - Viral sequence entries, part 130.
4572. gbvrl131.seq - Viral sequence entries, part 131.
4573. gbvrl132.seq - Viral sequence entries, part 132.
4574. gbvrl133.seq - Viral sequence entries, part 133.
4575. gbvrl134.seq - Viral sequence entries, part 134.
4576. gbvrl135.seq - Viral sequence entries, part 135.
4577. gbvrl136.seq - Viral sequence entries, part 136.
4578. gbvrl137.seq - Viral sequence entries, part 137.
4579. gbvrl138.seq - Viral sequence entries, part 138.
4580. gbvrl139.seq - Viral sequence entries, part 139.
4581. gbvrl14.seq - Viral sequence entries, part 14.
4582. gbvrl140.seq - Viral sequence entries, part 140.
4583. gbvrl141.seq - Viral sequence entries, part 141.
4584. gbvrl142.seq - Viral sequence entries, part 142.
4585. gbvrl143.seq - Viral sequence entries, part 143.
4586. gbvrl144.seq - Viral sequence entries, part 144.
4587. gbvrl145.seq - Viral sequence entries, part 145.
4588. gbvrl146.seq - Viral sequence entries, part 146.
4589. gbvrl147.seq - Viral sequence entries, part 147.
4590. gbvrl148.seq - Viral sequence entries, part 148.
4591. gbvrl149.seq - Viral sequence entries, part 149.
4592. gbvrl15.seq - Viral sequence entries, part 15.
4593. gbvrl150.seq - Viral sequence entries, part 150.
4594. gbvrl151.seq - Viral sequence entries, part 151.
4595. gbvrl152.seq - Viral sequence entries, part 152.
4596. gbvrl153.seq - Viral sequence entries, part 153.
4597. gbvrl154.seq - Viral sequence entries, part 154.
4598. gbvrl155.seq - Viral sequence entries, part 155.
4599. gbvrl156.seq - Viral sequence entries, part 156.
4600. gbvrl157.seq - Viral sequence entries, part 157.
4601. gbvrl158.seq - Viral sequence entries, part 158.
4602. gbvrl159.seq - Viral sequence entries, part 159.
4603. gbvrl16.seq - Viral sequence entries, part 16.
4604. gbvrl160.seq - Viral sequence entries, part 160.
4605. gbvrl161.seq - Viral sequence entries, part 161.
4606. gbvrl162.seq - Viral sequence entries, part 162.
4607. gbvrl163.seq - Viral sequence entries, part 163.
4608. gbvrl164.seq - Viral sequence entries, part 164.
4609. gbvrl165.seq - Viral sequence entries, part 165.
4610. gbvrl166.seq - Viral sequence entries, part 166.
4611. gbvrl167.seq - Viral sequence entries, part 167.
4612. gbvrl168.seq - Viral sequence entries, part 168.
4613. gbvrl169.seq - Viral sequence entries, part 169.
4614. gbvrl17.seq - Viral sequence entries, part 17.
4615. gbvrl170.seq - Viral sequence entries, part 170.
4616. gbvrl171.seq - Viral sequence entries, part 171.
4617. gbvrl172.seq - Viral sequence entries, part 172.
4618. gbvrl173.seq - Viral sequence entries, part 173.
4619. gbvrl174.seq - Viral sequence entries, part 174.
4620. gbvrl175.seq - Viral sequence entries, part 175.
4621. gbvrl176.seq - Viral sequence entries, part 176.
4622. gbvrl177.seq - Viral sequence entries, part 177.
4623. gbvrl178.seq - Viral sequence entries, part 178.
4624. gbvrl179.seq - Viral sequence entries, part 179.
4625. gbvrl18.seq - Viral sequence entries, part 18.
4626. gbvrl180.seq - Viral sequence entries, part 180.
4627. gbvrl181.seq - Viral sequence entries, part 181.
4628. gbvrl182.seq - Viral sequence entries, part 182.
4629. gbvrl183.seq - Viral sequence entries, part 183.
4630. gbvrl184.seq - Viral sequence entries, part 184.
4631. gbvrl185.seq - Viral sequence entries, part 185.
4632. gbvrl186.seq - Viral sequence entries, part 186.
4633. gbvrl187.seq - Viral sequence entries, part 187.
4634. gbvrl188.seq - Viral sequence entries, part 188.
4635. gbvrl189.seq - Viral sequence entries, part 189.
4636. gbvrl19.seq - Viral sequence entries, part 19.
4637. gbvrl190.seq - Viral sequence entries, part 190.
4638. gbvrl191.seq - Viral sequence entries, part 191.
4639. gbvrl192.seq - Viral sequence entries, part 192.
4640. gbvrl193.seq - Viral sequence entries, part 193.
4641. gbvrl194.seq - Viral sequence entries, part 194.
4642. gbvrl195.seq - Viral sequence entries, part 195.
4643. gbvrl196.seq - Viral sequence entries, part 196.
4644. gbvrl197.seq - Viral sequence entries, part 197.
4645. gbvrl198.seq - Viral sequence entries, part 198.
4646. gbvrl199.seq - Viral sequence entries, part 199.
4647. gbvrl2.seq - Viral sequence entries, part 2.
4648. gbvrl20.seq - Viral sequence entries, part 20.
4649. gbvrl200.seq - Viral sequence entries, part 200.
4650. gbvrl201.seq - Viral sequence entries, part 201.
4651. gbvrl202.seq - Viral sequence entries, part 202.
4652. gbvrl203.seq - Viral sequence entries, part 203.
4653. gbvrl204.seq - Viral sequence entries, part 204.
4654. gbvrl205.seq - Viral sequence entries, part 205.
4655. gbvrl206.seq - Viral sequence entries, part 206.
4656. gbvrl207.seq - Viral sequence entries, part 207.
4657. gbvrl208.seq - Viral sequence entries, part 208.
4658. gbvrl209.seq - Viral sequence entries, part 209.
4659. gbvrl21.seq - Viral sequence entries, part 21.
4660. gbvrl210.seq - Viral sequence entries, part 210.
4661. gbvrl211.seq - Viral sequence entries, part 211.
4662. gbvrl212.seq - Viral sequence entries, part 212.
4663. gbvrl213.seq - Viral sequence entries, part 213.
4664. gbvrl214.seq - Viral sequence entries, part 214.
4665. gbvrl215.seq - Viral sequence entries, part 215.
4666. gbvrl216.seq - Viral sequence entries, part 216.
4667. gbvrl217.seq - Viral sequence entries, part 217.
4668. gbvrl218.seq - Viral sequence entries, part 218.
4669. gbvrl219.seq - Viral sequence entries, part 219.
4670. gbvrl22.seq - Viral sequence entries, part 22.
4671. gbvrl220.seq - Viral sequence entries, part 220.
4672. gbvrl221.seq - Viral sequence entries, part 221.
4673. gbvrl222.seq - Viral sequence entries, part 222.
4674. gbvrl223.seq - Viral sequence entries, part 223.
4675. gbvrl224.seq - Viral sequence entries, part 224.
4676. gbvrl225.seq - Viral sequence entries, part 225.
4677. gbvrl226.seq - Viral sequence entries, part 226.
4678. gbvrl227.seq - Viral sequence entries, part 227.
4679. gbvrl228.seq - Viral sequence entries, part 228.
4680. gbvrl229.seq - Viral sequence entries, part 229.
4681. gbvrl23.seq - Viral sequence entries, part 23.
4682. gbvrl230.seq - Viral sequence entries, part 230.
4683. gbvrl231.seq - Viral sequence entries, part 231.
4684. gbvrl232.seq - Viral sequence entries, part 232.
4685. gbvrl233.seq - Viral sequence entries, part 233.
4686. gbvrl234.seq - Viral sequence entries, part 234.
4687. gbvrl235.seq - Viral sequence entries, part 235.
4688. gbvrl236.seq - Viral sequence entries, part 236.
4689. gbvrl237.seq - Viral sequence entries, part 237.
4690. gbvrl238.seq - Viral sequence entries, part 238.
4691. gbvrl239.seq - Viral sequence entries, part 239.
4692. gbvrl24.seq - Viral sequence entries, part 24.
4693. gbvrl240.seq - Viral sequence entries, part 240.
4694. gbvrl241.seq - Viral sequence entries, part 241.
4695. gbvrl242.seq - Viral sequence entries, part 242.
4696. gbvrl243.seq - Viral sequence entries, part 243.
4697. gbvrl244.seq - Viral sequence entries, part 244.
4698. gbvrl245.seq - Viral sequence entries, part 245.
4699. gbvrl246.seq - Viral sequence entries, part 246.
4700. gbvrl247.seq - Viral sequence entries, part 247.
4701. gbvrl248.seq - Viral sequence entries, part 248.
4702. gbvrl249.seq - Viral sequence entries, part 249.
4703. gbvrl25.seq - Viral sequence entries, part 25.
4704. gbvrl250.seq - Viral sequence entries, part 250.
4705. gbvrl251.seq - Viral sequence entries, part 251.
4706. gbvrl252.seq - Viral sequence entries, part 252.
4707. gbvrl253.seq - Viral sequence entries, part 253.
4708. gbvrl254.seq - Viral sequence entries, part 254.
4709. gbvrl255.seq - Viral sequence entries, part 255.
4710. gbvrl256.seq - Viral sequence entries, part 256.
4711. gbvrl257.seq - Viral sequence entries, part 257.
4712. gbvrl258.seq - Viral sequence entries, part 258.
4713. gbvrl259.seq - Viral sequence entries, part 259.
4714. gbvrl26.seq - Viral sequence entries, part 26.
4715. gbvrl260.seq - Viral sequence entries, part 260.
4716. gbvrl261.seq - Viral sequence entries, part 261.
4717. gbvrl262.seq - Viral sequence entries, part 262.
4718. gbvrl263.seq - Viral sequence entries, part 263.
4719. gbvrl264.seq - Viral sequence entries, part 264.
4720. gbvrl265.seq - Viral sequence entries, part 265.
4721. gbvrl266.seq - Viral sequence entries, part 266.
4722. gbvrl267.seq - Viral sequence entries, part 267.
4723. gbvrl268.seq - Viral sequence entries, part 268.
4724. gbvrl269.seq - Viral sequence entries, part 269.
4725. gbvrl27.seq - Viral sequence entries, part 27.
4726. gbvrl270.seq - Viral sequence entries, part 270.
4727. gbvrl271.seq - Viral sequence entries, part 271.
4728. gbvrl272.seq - Viral sequence entries, part 272.
4729. gbvrl273.seq - Viral sequence entries, part 273.
4730. gbvrl274.seq - Viral sequence entries, part 274.
4731. gbvrl275.seq - Viral sequence entries, part 275.
4732. gbvrl276.seq - Viral sequence entries, part 276.
4733. gbvrl277.seq - Viral sequence entries, part 277.
4734. gbvrl278.seq - Viral sequence entries, part 278.
4735. gbvrl279.seq - Viral sequence entries, part 279.
4736. gbvrl28.seq - Viral sequence entries, part 28.
4737. gbvrl280.seq - Viral sequence entries, part 280.
4738. gbvrl281.seq - Viral sequence entries, part 281.
4739. gbvrl282.seq - Viral sequence entries, part 282.
4740. gbvrl283.seq - Viral sequence entries, part 283.
4741. gbvrl284.seq - Viral sequence entries, part 284.
4742. gbvrl285.seq - Viral sequence entries, part 285.
4743. gbvrl286.seq - Viral sequence entries, part 286.
4744. gbvrl287.seq - Viral sequence entries, part 287.
4745. gbvrl288.seq - Viral sequence entries, part 288.
4746. gbvrl289.seq - Viral sequence entries, part 289.
4747. gbvrl29.seq - Viral sequence entries, part 29.
4748. gbvrl290.seq - Viral sequence entries, part 290.
4749. gbvrl291.seq - Viral sequence entries, part 291.
4750. gbvrl292.seq - Viral sequence entries, part 292.
4751. gbvrl293.seq - Viral sequence entries, part 293.
4752. gbvrl294.seq - Viral sequence entries, part 294.
4753. gbvrl295.seq - Viral sequence entries, part 295.
4754. gbvrl296.seq - Viral sequence entries, part 296.
4755. gbvrl297.seq - Viral sequence entries, part 297.
4756. gbvrl298.seq - Viral sequence entries, part 298.
4757. gbvrl299.seq - Viral sequence entries, part 299.
4758. gbvrl3.seq - Viral sequence entries, part 3.
4759. gbvrl30.seq - Viral sequence entries, part 30.
4760. gbvrl300.seq - Viral sequence entries, part 300.
4761. gbvrl301.seq - Viral sequence entries, part 301.
4762. gbvrl302.seq - Viral sequence entries, part 302.
4763. gbvrl303.seq - Viral sequence entries, part 303.
4764. gbvrl304.seq - Viral sequence entries, part 304.
4765. gbvrl305.seq - Viral sequence entries, part 305.
4766. gbvrl306.seq - Viral sequence entries, part 306.
4767. gbvrl307.seq - Viral sequence entries, part 307.
4768. gbvrl308.seq - Viral sequence entries, part 308.
4769. gbvrl309.seq - Viral sequence entries, part 309.
4770. gbvrl31.seq - Viral sequence entries, part 31.
4771. gbvrl310.seq - Viral sequence entries, part 310.
4772. gbvrl311.seq - Viral sequence entries, part 311.
4773. gbvrl312.seq - Viral sequence entries, part 312.
4774. gbvrl313.seq - Viral sequence entries, part 313.
4775. gbvrl314.seq - Viral sequence entries, part 314.
4776. gbvrl315.seq - Viral sequence entries, part 315.
4777. gbvrl316.seq - Viral sequence entries, part 316.
4778. gbvrl317.seq - Viral sequence entries, part 317.
4779. gbvrl318.seq - Viral sequence entries, part 318.
4780. gbvrl319.seq - Viral sequence entries, part 319.
4781. gbvrl32.seq - Viral sequence entries, part 32.
4782. gbvrl320.seq - Viral sequence entries, part 320.
4783. gbvrl321.seq - Viral sequence entries, part 321.
4784. gbvrl322.seq - Viral sequence entries, part 322.
4785. gbvrl323.seq - Viral sequence entries, part 323.
4786. gbvrl324.seq - Viral sequence entries, part 324.
4787. gbvrl325.seq - Viral sequence entries, part 325.
4788. gbvrl326.seq - Viral sequence entries, part 326.
4789. gbvrl327.seq - Viral sequence entries, part 327.
4790. gbvrl328.seq - Viral sequence entries, part 328.
4791. gbvrl329.seq - Viral sequence entries, part 329.
4792. gbvrl33.seq - Viral sequence entries, part 33.
4793. gbvrl330.seq - Viral sequence entries, part 330.
4794. gbvrl331.seq - Viral sequence entries, part 331.
4795. gbvrl332.seq - Viral sequence entries, part 332.
4796. gbvrl333.seq - Viral sequence entries, part 333.
4797. gbvrl334.seq - Viral sequence entries, part 334.
4798. gbvrl335.seq - Viral sequence entries, part 335.
4799. gbvrl336.seq - Viral sequence entries, part 336.
4800. gbvrl337.seq - Viral sequence entries, part 337.
4801. gbvrl338.seq - Viral sequence entries, part 338.
4802. gbvrl339.seq - Viral sequence entries, part 339.
4803. gbvrl34.seq - Viral sequence entries, part 34.
4804. gbvrl340.seq - Viral sequence entries, part 340.
4805. gbvrl341.seq - Viral sequence entries, part 341.
4806. gbvrl342.seq - Viral sequence entries, part 342.
4807. gbvrl343.seq - Viral sequence entries, part 343.
4808. gbvrl344.seq - Viral sequence entries, part 344.
4809. gbvrl345.seq - Viral sequence entries, part 345.
4810. gbvrl346.seq - Viral sequence entries, part 346.
4811. gbvrl347.seq - Viral sequence entries, part 347.
4812. gbvrl348.seq - Viral sequence entries, part 348.
4813. gbvrl349.seq - Viral sequence entries, part 349.
4814. gbvrl35.seq - Viral sequence entries, part 35.
4815. gbvrl350.seq - Viral sequence entries, part 350.
4816. gbvrl351.seq - Viral sequence entries, part 351.
4817. gbvrl352.seq - Viral sequence entries, part 352.
4818. gbvrl353.seq - Viral sequence entries, part 353.
4819. gbvrl354.seq - Viral sequence entries, part 354.
4820. gbvrl355.seq - Viral sequence entries, part 355.
4821. gbvrl356.seq - Viral sequence entries, part 356.
4822. gbvrl357.seq - Viral sequence entries, part 357.
4823. gbvrl358.seq - Viral sequence entries, part 358.
4824. gbvrl359.seq - Viral sequence entries, part 359.
4825. gbvrl36.seq - Viral sequence entries, part 36.
4826. gbvrl360.seq - Viral sequence entries, part 360.
4827. gbvrl361.seq - Viral sequence entries, part 361.
4828. gbvrl362.seq - Viral sequence entries, part 362.
4829. gbvrl363.seq - Viral sequence entries, part 363.
4830. gbvrl364.seq - Viral sequence entries, part 364.
4831. gbvrl365.seq - Viral sequence entries, part 365.
4832. gbvrl366.seq - Viral sequence entries, part 366.
4833. gbvrl367.seq - Viral sequence entries, part 367.
4834. gbvrl368.seq - Viral sequence entries, part 368.
4835. gbvrl369.seq - Viral sequence entries, part 369.
4836. gbvrl37.seq - Viral sequence entries, part 37.
4837. gbvrl370.seq - Viral sequence entries, part 370.
4838. gbvrl371.seq - Viral sequence entries, part 371.
4839. gbvrl372.seq - Viral sequence entries, part 372.
4840. gbvrl373.seq - Viral sequence entries, part 373.
4841. gbvrl374.seq - Viral sequence entries, part 374.
4842. gbvrl375.seq - Viral sequence entries, part 375.
4843. gbvrl376.seq - Viral sequence entries, part 376.
4844. gbvrl377.seq - Viral sequence entries, part 377.
4845. gbvrl378.seq - Viral sequence entries, part 378.
4846. gbvrl379.seq - Viral sequence entries, part 379.
4847. gbvrl38.seq - Viral sequence entries, part 38.
4848. gbvrl380.seq - Viral sequence entries, part 380.
4849. gbvrl381.seq - Viral sequence entries, part 381.
4850. gbvrl382.seq - Viral sequence entries, part 382.
4851. gbvrl383.seq - Viral sequence entries, part 383.
4852. gbvrl384.seq - Viral sequence entries, part 384.
4853. gbvrl385.seq - Viral sequence entries, part 385.
4854. gbvrl386.seq - Viral sequence entries, part 386.
4855. gbvrl387.seq - Viral sequence entries, part 387.
4856. gbvrl388.seq - Viral sequence entries, part 388.
4857. gbvrl389.seq - Viral sequence entries, part 389.
4858. gbvrl39.seq - Viral sequence entries, part 39.
4859. gbvrl390.seq - Viral sequence entries, part 390.
4860. gbvrl391.seq - Viral sequence entries, part 391.
4861. gbvrl392.seq - Viral sequence entries, part 392.
4862. gbvrl393.seq - Viral sequence entries, part 393.
4863. gbvrl394.seq - Viral sequence entries, part 394.
4864. gbvrl395.seq - Viral sequence entries, part 395.
4865. gbvrl396.seq - Viral sequence entries, part 396.
4866. gbvrl397.seq - Viral sequence entries, part 397.
4867. gbvrl398.seq - Viral sequence entries, part 398.
4868. gbvrl399.seq - Viral sequence entries, part 399.
4869. gbvrl4.seq - Viral sequence entries, part 4.
4870. gbvrl40.seq - Viral sequence entries, part 40.
4871. gbvrl400.seq - Viral sequence entries, part 400.
4872. gbvrl401.seq - Viral sequence entries, part 401.
4873. gbvrl402.seq - Viral sequence entries, part 402.
4874. gbvrl403.seq - Viral sequence entries, part 403.
4875. gbvrl404.seq - Viral sequence entries, part 404.
4876. gbvrl405.seq - Viral sequence entries, part 405.
4877. gbvrl406.seq - Viral sequence entries, part 406.
4878. gbvrl407.seq - Viral sequence entries, part 407.
4879. gbvrl408.seq - Viral sequence entries, part 408.
4880. gbvrl409.seq - Viral sequence entries, part 409.
4881. gbvrl41.seq - Viral sequence entries, part 41.
4882. gbvrl410.seq - Viral sequence entries, part 410.
4883. gbvrl411.seq - Viral sequence entries, part 411.
4884. gbvrl412.seq - Viral sequence entries, part 412.
4885. gbvrl413.seq - Viral sequence entries, part 413.
4886. gbvrl414.seq - Viral sequence entries, part 414.
4887. gbvrl415.seq - Viral sequence entries, part 415.
4888. gbvrl416.seq - Viral sequence entries, part 416.
4889. gbvrl417.seq - Viral sequence entries, part 417.
4890. gbvrl418.seq - Viral sequence entries, part 418.
4891. gbvrl419.seq - Viral sequence entries, part 419.
4892. gbvrl42.seq - Viral sequence entries, part 42.
4893. gbvrl420.seq - Viral sequence entries, part 420.
4894. gbvrl421.seq - Viral sequence entries, part 421.
4895. gbvrl422.seq - Viral sequence entries, part 422.
4896. gbvrl423.seq - Viral sequence entries, part 423.
4897. gbvrl424.seq - Viral sequence entries, part 424.
4898. gbvrl425.seq - Viral sequence entries, part 425.
4899. gbvrl426.seq - Viral sequence entries, part 426.
4900. gbvrl427.seq - Viral sequence entries, part 427.
4901. gbvrl428.seq - Viral sequence entries, part 428.
4902. gbvrl429.seq - Viral sequence entries, part 429.
4903. gbvrl43.seq - Viral sequence entries, part 43.
4904. gbvrl430.seq - Viral sequence entries, part 430.
4905. gbvrl431.seq - Viral sequence entries, part 431.
4906. gbvrl432.seq - Viral sequence entries, part 432.
4907. gbvrl433.seq - Viral sequence entries, part 433.
4908. gbvrl434.seq - Viral sequence entries, part 434.
4909. gbvrl435.seq - Viral sequence entries, part 435.
4910. gbvrl436.seq - Viral sequence entries, part 436.
4911. gbvrl437.seq - Viral sequence entries, part 437.
4912. gbvrl438.seq - Viral sequence entries, part 438.
4913. gbvrl439.seq - Viral sequence entries, part 439.
4914. gbvrl44.seq - Viral sequence entries, part 44.
4915. gbvrl440.seq - Viral sequence entries, part 440.
4916. gbvrl441.seq - Viral sequence entries, part 441.
4917. gbvrl442.seq - Viral sequence entries, part 442.
4918. gbvrl443.seq - Viral sequence entries, part 443.
4919. gbvrl444.seq - Viral sequence entries, part 444.
4920. gbvrl445.seq - Viral sequence entries, part 445.
4921. gbvrl446.seq - Viral sequence entries, part 446.
4922. gbvrl447.seq - Viral sequence entries, part 447.
4923. gbvrl448.seq - Viral sequence entries, part 448.
4924. gbvrl449.seq - Viral sequence entries, part 449.
4925. gbvrl45.seq - Viral sequence entries, part 45.
4926. gbvrl450.seq - Viral sequence entries, part 450.
4927. gbvrl451.seq - Viral sequence entries, part 451.
4928. gbvrl452.seq - Viral sequence entries, part 452.
4929. gbvrl453.seq - Viral sequence entries, part 453.
4930. gbvrl454.seq - Viral sequence entries, part 454.
4931. gbvrl455.seq - Viral sequence entries, part 455.
4932. gbvrl456.seq - Viral sequence entries, part 456.
4933. gbvrl457.seq - Viral sequence entries, part 457.
4934. gbvrl458.seq - Viral sequence entries, part 458.
4935. gbvrl459.seq - Viral sequence entries, part 459.
4936. gbvrl46.seq - Viral sequence entries, part 46.
4937. gbvrl460.seq - Viral sequence entries, part 460.
4938. gbvrl461.seq - Viral sequence entries, part 461.
4939. gbvrl462.seq - Viral sequence entries, part 462.
4940. gbvrl463.seq - Viral sequence entries, part 463.
4941. gbvrl464.seq - Viral sequence entries, part 464.
4942. gbvrl465.seq - Viral sequence entries, part 465.
4943. gbvrl466.seq - Viral sequence entries, part 466.
4944. gbvrl467.seq - Viral sequence entries, part 467.
4945. gbvrl468.seq - Viral sequence entries, part 468.
4946. gbvrl469.seq - Viral sequence entries, part 469.
4947. gbvrl47.seq - Viral sequence entries, part 47.
4948. gbvrl470.seq - Viral sequence entries, part 470.
4949. gbvrl471.seq - Viral sequence entries, part 471.
4950. gbvrl472.seq - Viral sequence entries, part 472.
4951. gbvrl473.seq - Viral sequence entries, part 473.
4952. gbvrl474.seq - Viral sequence entries, part 474.
4953. gbvrl475.seq - Viral sequence entries, part 475.
4954. gbvrl476.seq - Viral sequence entries, part 476.
4955. gbvrl477.seq - Viral sequence entries, part 477.
4956. gbvrl478.seq - Viral sequence entries, part 478.
4957. gbvrl479.seq - Viral sequence entries, part 479.
4958. gbvrl48.seq - Viral sequence entries, part 48.
4959. gbvrl480.seq - Viral sequence entries, part 480.
4960. gbvrl481.seq - Viral sequence entries, part 481.
4961. gbvrl482.seq - Viral sequence entries, part 482.
4962. gbvrl483.seq - Viral sequence entries, part 483.
4963. gbvrl484.seq - Viral sequence entries, part 484.
4964. gbvrl485.seq - Viral sequence entries, part 485.
4965. gbvrl486.seq - Viral sequence entries, part 486.
4966. gbvrl487.seq - Viral sequence entries, part 487.
4967. gbvrl488.seq - Viral sequence entries, part 488.
4968. gbvrl489.seq - Viral sequence entries, part 489.
4969. gbvrl49.seq - Viral sequence entries, part 49.
4970. gbvrl490.seq - Viral sequence entries, part 490.
4971. gbvrl491.seq - Viral sequence entries, part 491.
4972. gbvrl492.seq - Viral sequence entries, part 492.
4973. gbvrl493.seq - Viral sequence entries, part 493.
4974. gbvrl494.seq - Viral sequence entries, part 494.
4975. gbvrl495.seq - Viral sequence entries, part 495.
4976. gbvrl496.seq - Viral sequence entries, part 496.
4977. gbvrl497.seq - Viral sequence entries, part 497.
4978. gbvrl498.seq - Viral sequence entries, part 498.
4979. gbvrl499.seq - Viral sequence entries, part 499.
4980. gbvrl5.seq - Viral sequence entries, part 5.
4981. gbvrl50.seq - Viral sequence entries, part 50.
4982. gbvrl500.seq - Viral sequence entries, part 500.
4983. gbvrl501.seq - Viral sequence entries, part 501.
4984. gbvrl502.seq - Viral sequence entries, part 502.
4985. gbvrl503.seq - Viral sequence entries, part 503.
4986. gbvrl504.seq - Viral sequence entries, part 504.
4987. gbvrl51.seq - Viral sequence entries, part 51.
4988. gbvrl52.seq - Viral sequence entries, part 52.
4989. gbvrl53.seq - Viral sequence entries, part 53.
4990. gbvrl54.seq - Viral sequence entries, part 54.
4991. gbvrl55.seq - Viral sequence entries, part 55.
4992. gbvrl56.seq - Viral sequence entries, part 56.
4993. gbvrl57.seq - Viral sequence entries, part 57.
4994. gbvrl58.seq - Viral sequence entries, part 58.
4995. gbvrl59.seq - Viral sequence entries, part 59.
4996. gbvrl6.seq - Viral sequence entries, part 6.
4997. gbvrl60.seq - Viral sequence entries, part 60.
4998. gbvrl61.seq - Viral sequence entries, part 61.
4999. gbvrl62.seq - Viral sequence entries, part 62.
5000. gbvrl63.seq - Viral sequence entries, part 63.
5001. gbvrl64.seq - Viral sequence entries, part 64.
5002. gbvrl65.seq - Viral sequence entries, part 65.
5003. gbvrl66.seq - Viral sequence entries, part 66.
5004. gbvrl67.seq - Viral sequence entries, part 67.
5005. gbvrl68.seq - Viral sequence entries, part 68.
5006. gbvrl69.seq - Viral sequence entries, part 69.
5007. gbvrl7.seq - Viral sequence entries, part 7.
5008. gbvrl70.seq - Viral sequence entries, part 70.
5009. gbvrl71.seq - Viral sequence entries, part 71.
5010. gbvrl72.seq - Viral sequence entries, part 72.
5011. gbvrl73.seq - Viral sequence entries, part 73.
5012. gbvrl74.seq - Viral sequence entries, part 74.
5013. gbvrl75.seq - Viral sequence entries, part 75.
5014. gbvrl76.seq - Viral sequence entries, part 76.
5015. gbvrl77.seq - Viral sequence entries, part 77.
5016. gbvrl78.seq - Viral sequence entries, part 78.
5017. gbvrl79.seq - Viral sequence entries, part 79.
5018. gbvrl8.seq - Viral sequence entries, part 8.
5019. gbvrl80.seq - Viral sequence entries, part 80.
5020. gbvrl81.seq - Viral sequence entries, part 81.
5021. gbvrl82.seq - Viral sequence entries, part 82.
5022. gbvrl83.seq - Viral sequence entries, part 83.
5023. gbvrl84.seq - Viral sequence entries, part 84.
5024. gbvrl85.seq - Viral sequence entries, part 85.
5025. gbvrl86.seq - Viral sequence entries, part 86.
5026. gbvrl87.seq - Viral sequence entries, part 87.
5027. gbvrl88.seq - Viral sequence entries, part 88.
5028. gbvrl89.seq - Viral sequence entries, part 89.
5029. gbvrl9.seq - Viral sequence entries, part 9.
5030. gbvrl90.seq - Viral sequence entries, part 90.
5031. gbvrl91.seq - Viral sequence entries, part 91.
5032. gbvrl92.seq - Viral sequence entries, part 92.
5033. gbvrl93.seq - Viral sequence entries, part 93.
5034. gbvrl94.seq - Viral sequence entries, part 94.
5035. gbvrl95.seq - Viral sequence entries, part 95.
5036. gbvrl96.seq - Viral sequence entries, part 96.
5037. gbvrl97.seq - Viral sequence entries, part 97.
5038. gbvrl98.seq - Viral sequence entries, part 98.
5039. gbvrl99.seq - Viral sequence entries, part 99.
5040. gbvrt1.seq - Other vertebrate sequence entries, part 1.
5041. gbvrt10.seq - Other vertebrate sequence entries, part 10.
5042. gbvrt100.seq - Other vertebrate sequence entries, part 100.
5043. gbvrt101.seq - Other vertebrate sequence entries, part 101.
5044. gbvrt102.seq - Other vertebrate sequence entries, part 102.
5045. gbvrt103.seq - Other vertebrate sequence entries, part 103.
5046. gbvrt104.seq - Other vertebrate sequence entries, part 104.
5047. gbvrt105.seq - Other vertebrate sequence entries, part 105.
5048. gbvrt106.seq - Other vertebrate sequence entries, part 106.
5049. gbvrt107.seq - Other vertebrate sequence entries, part 107.
5050. gbvrt108.seq - Other vertebrate sequence entries, part 108.
5051. gbvrt109.seq - Other vertebrate sequence entries, part 109.
5052. gbvrt11.seq - Other vertebrate sequence entries, part 11.
5053. gbvrt110.seq - Other vertebrate sequence entries, part 110.
5054. gbvrt111.seq - Other vertebrate sequence entries, part 111.
5055. gbvrt112.seq - Other vertebrate sequence entries, part 112.
5056. gbvrt113.seq - Other vertebrate sequence entries, part 113.
5057. gbvrt114.seq - Other vertebrate sequence entries, part 114.
5058. gbvrt115.seq - Other vertebrate sequence entries, part 115.
5059. gbvrt116.seq - Other vertebrate sequence entries, part 116.
5060. gbvrt117.seq - Other vertebrate sequence entries, part 117.
5061. gbvrt118.seq - Other vertebrate sequence entries, part 118.
5062. gbvrt119.seq - Other vertebrate sequence entries, part 119.
5063. gbvrt12.seq - Other vertebrate sequence entries, part 12.
5064. gbvrt120.seq - Other vertebrate sequence entries, part 120.
5065. gbvrt121.seq - Other vertebrate sequence entries, part 121.
5066. gbvrt122.seq - Other vertebrate sequence entries, part 122.
5067. gbvrt123.seq - Other vertebrate sequence entries, part 123.
5068. gbvrt124.seq - Other vertebrate sequence entries, part 124.
5069. gbvrt125.seq - Other vertebrate sequence entries, part 125.
5070. gbvrt126.seq - Other vertebrate sequence entries, part 126.
5071. gbvrt127.seq - Other vertebrate sequence entries, part 127.
5072. gbvrt128.seq - Other vertebrate sequence entries, part 128.
5073. gbvrt129.seq - Other vertebrate sequence entries, part 129.
5074. gbvrt13.seq - Other vertebrate sequence entries, part 13.
5075. gbvrt130.seq - Other vertebrate sequence entries, part 130.
5076. gbvrt131.seq - Other vertebrate sequence entries, part 131.
5077. gbvrt132.seq - Other vertebrate sequence entries, part 132.
5078. gbvrt133.seq - Other vertebrate sequence entries, part 133.
5079. gbvrt134.seq - Other vertebrate sequence entries, part 134.
5080. gbvrt135.seq - Other vertebrate sequence entries, part 135.
5081. gbvrt136.seq - Other vertebrate sequence entries, part 136.
5082. gbvrt137.seq - Other vertebrate sequence entries, part 137.
5083. gbvrt138.seq - Other vertebrate sequence entries, part 138.
5084. gbvrt139.seq - Other vertebrate sequence entries, part 139.
5085. gbvrt14.seq - Other vertebrate sequence entries, part 14.
5086. gbvrt140.seq - Other vertebrate sequence entries, part 140.
5087. gbvrt141.seq - Other vertebrate sequence entries, part 141.
5088. gbvrt142.seq - Other vertebrate sequence entries, part 142.
5089. gbvrt143.seq - Other vertebrate sequence entries, part 143.
5090. gbvrt144.seq - Other vertebrate sequence entries, part 144.
5091. gbvrt145.seq - Other vertebrate sequence entries, part 145.
5092. gbvrt146.seq - Other vertebrate sequence entries, part 146.
5093. gbvrt147.seq - Other vertebrate sequence entries, part 147.
5094. gbvrt148.seq - Other vertebrate sequence entries, part 148.
5095. gbvrt149.seq - Other vertebrate sequence entries, part 149.
5096. gbvrt15.seq - Other vertebrate sequence entries, part 15.
5097. gbvrt150.seq - Other vertebrate sequence entries, part 150.
5098. gbvrt151.seq - Other vertebrate sequence entries, part 151.
5099. gbvrt152.seq - Other vertebrate sequence entries, part 152.
5100. gbvrt153.seq - Other vertebrate sequence entries, part 153.
5101. gbvrt154.seq - Other vertebrate sequence entries, part 154.
5102. gbvrt155.seq - Other vertebrate sequence entries, part 155.
5103. gbvrt156.seq - Other vertebrate sequence entries, part 156.
5104. gbvrt157.seq - Other vertebrate sequence entries, part 157.
5105. gbvrt158.seq - Other vertebrate sequence entries, part 158.
5106. gbvrt159.seq - Other vertebrate sequence entries, part 159.
5107. gbvrt16.seq - Other vertebrate sequence entries, part 16.
5108. gbvrt160.seq - Other vertebrate sequence entries, part 160.
5109. gbvrt161.seq - Other vertebrate sequence entries, part 161.
5110. gbvrt162.seq - Other vertebrate sequence entries, part 162.
5111. gbvrt163.seq - Other vertebrate sequence entries, part 163.
5112. gbvrt164.seq - Other vertebrate sequence entries, part 164.
5113. gbvrt165.seq - Other vertebrate sequence entries, part 165.
5114. gbvrt166.seq - Other vertebrate sequence entries, part 166.
5115. gbvrt167.seq - Other vertebrate sequence entries, part 167.
5116. gbvrt168.seq - Other vertebrate sequence entries, part 168.
5117. gbvrt169.seq - Other vertebrate sequence entries, part 169.
5118. gbvrt17.seq - Other vertebrate sequence entries, part 17.
5119. gbvrt170.seq - Other vertebrate sequence entries, part 170.
5120. gbvrt171.seq - Other vertebrate sequence entries, part 171.
5121. gbvrt172.seq - Other vertebrate sequence entries, part 172.
5122. gbvrt173.seq - Other vertebrate sequence entries, part 173.
5123. gbvrt174.seq - Other vertebrate sequence entries, part 174.
5124. gbvrt175.seq - Other vertebrate sequence entries, part 175.
5125. gbvrt176.seq - Other vertebrate sequence entries, part 176.
5126. gbvrt177.seq - Other vertebrate sequence entries, part 177.
5127. gbvrt178.seq - Other vertebrate sequence entries, part 178.
5128. gbvrt179.seq - Other vertebrate sequence entries, part 179.
5129. gbvrt18.seq - Other vertebrate sequence entries, part 18.
5130. gbvrt180.seq - Other vertebrate sequence entries, part 180.
5131. gbvrt181.seq - Other vertebrate sequence entries, part 181.
5132. gbvrt182.seq - Other vertebrate sequence entries, part 182.
5133. gbvrt183.seq - Other vertebrate sequence entries, part 183.
5134. gbvrt184.seq - Other vertebrate sequence entries, part 184.
5135. gbvrt185.seq - Other vertebrate sequence entries, part 185.
5136. gbvrt186.seq - Other vertebrate sequence entries, part 186.
5137. gbvrt187.seq - Other vertebrate sequence entries, part 187.
5138. gbvrt188.seq - Other vertebrate sequence entries, part 188.
5139. gbvrt189.seq - Other vertebrate sequence entries, part 189.
5140. gbvrt19.seq - Other vertebrate sequence entries, part 19.
5141. gbvrt190.seq - Other vertebrate sequence entries, part 190.
5142. gbvrt191.seq - Other vertebrate sequence entries, part 191.
5143. gbvrt192.seq - Other vertebrate sequence entries, part 192.
5144. gbvrt193.seq - Other vertebrate sequence entries, part 193.
5145. gbvrt194.seq - Other vertebrate sequence entries, part 194.
5146. gbvrt195.seq - Other vertebrate sequence entries, part 195.
5147. gbvrt196.seq - Other vertebrate sequence entries, part 196.
5148. gbvrt197.seq - Other vertebrate sequence entries, part 197.
5149. gbvrt198.seq - Other vertebrate sequence entries, part 198.
5150. gbvrt199.seq - Other vertebrate sequence entries, part 199.
5151. gbvrt2.seq - Other vertebrate sequence entries, part 2.
5152. gbvrt20.seq - Other vertebrate sequence entries, part 20.
5153. gbvrt200.seq - Other vertebrate sequence entries, part 200.
5154. gbvrt201.seq - Other vertebrate sequence entries, part 201.
5155. gbvrt202.seq - Other vertebrate sequence entries, part 202.
5156. gbvrt203.seq - Other vertebrate sequence entries, part 203.
5157. gbvrt204.seq - Other vertebrate sequence entries, part 204.
5158. gbvrt205.seq - Other vertebrate sequence entries, part 205.
5159. gbvrt206.seq - Other vertebrate sequence entries, part 206.
5160. gbvrt207.seq - Other vertebrate sequence entries, part 207.
5161. gbvrt208.seq - Other vertebrate sequence entries, part 208.
5162. gbvrt209.seq - Other vertebrate sequence entries, part 209.
5163. gbvrt21.seq - Other vertebrate sequence entries, part 21.
5164. gbvrt210.seq - Other vertebrate sequence entries, part 210.
5165. gbvrt211.seq - Other vertebrate sequence entries, part 211.
5166. gbvrt212.seq - Other vertebrate sequence entries, part 212.
5167. gbvrt213.seq - Other vertebrate sequence entries, part 213.
5168. gbvrt214.seq - Other vertebrate sequence entries, part 214.
5169. gbvrt215.seq - Other vertebrate sequence entries, part 215.
5170. gbvrt216.seq - Other vertebrate sequence entries, part 216.
5171. gbvrt217.seq - Other vertebrate sequence entries, part 217.
5172. gbvrt218.seq - Other vertebrate sequence entries, part 218.
5173. gbvrt219.seq - Other vertebrate sequence entries, part 219.
5174. gbvrt22.seq - Other vertebrate sequence entries, part 22.
5175. gbvrt220.seq - Other vertebrate sequence entries, part 220.
5176. gbvrt221.seq - Other vertebrate sequence entries, part 221.
5177. gbvrt222.seq - Other vertebrate sequence entries, part 222.
5178. gbvrt223.seq - Other vertebrate sequence entries, part 223.
5179. gbvrt224.seq - Other vertebrate sequence entries, part 224.
5180. gbvrt225.seq - Other vertebrate sequence entries, part 225.
5181. gbvrt226.seq - Other vertebrate sequence entries, part 226.
5182. gbvrt227.seq - Other vertebrate sequence entries, part 227.
5183. gbvrt228.seq - Other vertebrate sequence entries, part 228.
5184. gbvrt229.seq - Other vertebrate sequence entries, part 229.
5185. gbvrt23.seq - Other vertebrate sequence entries, part 23.
5186. gbvrt230.seq - Other vertebrate sequence entries, part 230.
5187. gbvrt231.seq - Other vertebrate sequence entries, part 231.
5188. gbvrt232.seq - Other vertebrate sequence entries, part 232.
5189. gbvrt233.seq - Other vertebrate sequence entries, part 233.
5190. gbvrt234.seq - Other vertebrate sequence entries, part 234.
5191. gbvrt235.seq - Other vertebrate sequence entries, part 235.
5192. gbvrt236.seq - Other vertebrate sequence entries, part 236.
5193. gbvrt237.seq - Other vertebrate sequence entries, part 237.
5194. gbvrt238.seq - Other vertebrate sequence entries, part 238.
5195. gbvrt239.seq - Other vertebrate sequence entries, part 239.
5196. gbvrt24.seq - Other vertebrate sequence entries, part 24.
5197. gbvrt240.seq - Other vertebrate sequence entries, part 240.
5198. gbvrt241.seq - Other vertebrate sequence entries, part 241.
5199. gbvrt242.seq - Other vertebrate sequence entries, part 242.
5200. gbvrt243.seq - Other vertebrate sequence entries, part 243.
5201. gbvrt244.seq - Other vertebrate sequence entries, part 244.
5202. gbvrt245.seq - Other vertebrate sequence entries, part 245.
5203. gbvrt246.seq - Other vertebrate sequence entries, part 246.
5204. gbvrt247.seq - Other vertebrate sequence entries, part 247.
5205. gbvrt248.seq - Other vertebrate sequence entries, part 248.
5206. gbvrt249.seq - Other vertebrate sequence entries, part 249.
5207. gbvrt25.seq - Other vertebrate sequence entries, part 25.
5208. gbvrt250.seq - Other vertebrate sequence entries, part 250.
5209. gbvrt251.seq - Other vertebrate sequence entries, part 251.
5210. gbvrt252.seq - Other vertebrate sequence entries, part 252.
5211. gbvrt253.seq - Other vertebrate sequence entries, part 253.
5212. gbvrt254.seq - Other vertebrate sequence entries, part 254.
5213. gbvrt255.seq - Other vertebrate sequence entries, part 255.
5214. gbvrt256.seq - Other vertebrate sequence entries, part 256.
5215. gbvrt257.seq - Other vertebrate sequence entries, part 257.
5216. gbvrt258.seq - Other vertebrate sequence entries, part 258.
5217. gbvrt259.seq - Other vertebrate sequence entries, part 259.
5218. gbvrt26.seq - Other vertebrate sequence entries, part 26.
5219. gbvrt260.seq - Other vertebrate sequence entries, part 260.
5220. gbvrt261.seq - Other vertebrate sequence entries, part 261.
5221. gbvrt262.seq - Other vertebrate sequence entries, part 262.
5222. gbvrt263.seq - Other vertebrate sequence entries, part 263.
5223. gbvrt264.seq - Other vertebrate sequence entries, part 264.
5224. gbvrt265.seq - Other vertebrate sequence entries, part 265.
5225. gbvrt266.seq - Other vertebrate sequence entries, part 266.
5226. gbvrt267.seq - Other vertebrate sequence entries, part 267.
5227. gbvrt268.seq - Other vertebrate sequence entries, part 268.
5228. gbvrt269.seq - Other vertebrate sequence entries, part 269.
5229. gbvrt27.seq - Other vertebrate sequence entries, part 27.
5230. gbvrt270.seq - Other vertebrate sequence entries, part 270.
5231. gbvrt271.seq - Other vertebrate sequence entries, part 271.
5232. gbvrt272.seq - Other vertebrate sequence entries, part 272.
5233. gbvrt273.seq - Other vertebrate sequence entries, part 273.
5234. gbvrt274.seq - Other vertebrate sequence entries, part 274.
5235. gbvrt275.seq - Other vertebrate sequence entries, part 275.
5236. gbvrt276.seq - Other vertebrate sequence entries, part 276.
5237. gbvrt277.seq - Other vertebrate sequence entries, part 277.
5238. gbvrt278.seq - Other vertebrate sequence entries, part 278.
5239. gbvrt279.seq - Other vertebrate sequence entries, part 279.
5240. gbvrt28.seq - Other vertebrate sequence entries, part 28.
5241. gbvrt280.seq - Other vertebrate sequence entries, part 280.
5242. gbvrt281.seq - Other vertebrate sequence entries, part 281.
5243. gbvrt282.seq - Other vertebrate sequence entries, part 282.
5244. gbvrt283.seq - Other vertebrate sequence entries, part 283.
5245. gbvrt284.seq - Other vertebrate sequence entries, part 284.
5246. gbvrt285.seq - Other vertebrate sequence entries, part 285.
5247. gbvrt286.seq - Other vertebrate sequence entries, part 286.
5248. gbvrt287.seq - Other vertebrate sequence entries, part 287.
5249. gbvrt288.seq - Other vertebrate sequence entries, part 288.
5250. gbvrt289.seq - Other vertebrate sequence entries, part 289.
5251. gbvrt29.seq - Other vertebrate sequence entries, part 29.
5252. gbvrt290.seq - Other vertebrate sequence entries, part 290.
5253. gbvrt291.seq - Other vertebrate sequence entries, part 291.
5254. gbvrt292.seq - Other vertebrate sequence entries, part 292.
5255. gbvrt293.seq - Other vertebrate sequence entries, part 293.
5256. gbvrt294.seq - Other vertebrate sequence entries, part 294.
5257. gbvrt295.seq - Other vertebrate sequence entries, part 295.
5258. gbvrt296.seq - Other vertebrate sequence entries, part 296.
5259. gbvrt297.seq - Other vertebrate sequence entries, part 297.
5260. gbvrt298.seq - Other vertebrate sequence entries, part 298.
5261. gbvrt299.seq - Other vertebrate sequence entries, part 299.
5262. gbvrt3.seq - Other vertebrate sequence entries, part 3.
5263. gbvrt30.seq - Other vertebrate sequence entries, part 30.
5264. gbvrt300.seq - Other vertebrate sequence entries, part 300.
5265. gbvrt301.seq - Other vertebrate sequence entries, part 301.
5266. gbvrt302.seq - Other vertebrate sequence entries, part 302.
5267. gbvrt303.seq - Other vertebrate sequence entries, part 303.
5268. gbvrt304.seq - Other vertebrate sequence entries, part 304.
5269. gbvrt305.seq - Other vertebrate sequence entries, part 305.
5270. gbvrt306.seq - Other vertebrate sequence entries, part 306.
5271. gbvrt307.seq - Other vertebrate sequence entries, part 307.
5272. gbvrt308.seq - Other vertebrate sequence entries, part 308.
5273. gbvrt309.seq - Other vertebrate sequence entries, part 309.
5274. gbvrt31.seq - Other vertebrate sequence entries, part 31.
5275. gbvrt310.seq - Other vertebrate sequence entries, part 310.
5276. gbvrt311.seq - Other vertebrate sequence entries, part 311.
5277. gbvrt312.seq - Other vertebrate sequence entries, part 312.
5278. gbvrt313.seq - Other vertebrate sequence entries, part 313.
5279. gbvrt314.seq - Other vertebrate sequence entries, part 314.
5280. gbvrt315.seq - Other vertebrate sequence entries, part 315.
5281. gbvrt316.seq - Other vertebrate sequence entries, part 316.
5282. gbvrt317.seq - Other vertebrate sequence entries, part 317.
5283. gbvrt318.seq - Other vertebrate sequence entries, part 318.
5284. gbvrt319.seq - Other vertebrate sequence entries, part 319.
5285. gbvrt32.seq - Other vertebrate sequence entries, part 32.
5286. gbvrt320.seq - Other vertebrate sequence entries, part 320.
5287. gbvrt321.seq - Other vertebrate sequence entries, part 321.
5288. gbvrt322.seq - Other vertebrate sequence entries, part 322.
5289. gbvrt323.seq - Other vertebrate sequence entries, part 323.
5290. gbvrt324.seq - Other vertebrate sequence entries, part 324.
5291. gbvrt325.seq - Other vertebrate sequence entries, part 325.
5292. gbvrt326.seq - Other vertebrate sequence entries, part 326.
5293. gbvrt327.seq - Other vertebrate sequence entries, part 327.
5294. gbvrt328.seq - Other vertebrate sequence entries, part 328.
5295. gbvrt329.seq - Other vertebrate sequence entries, part 329.
5296. gbvrt33.seq - Other vertebrate sequence entries, part 33.
5297. gbvrt330.seq - Other vertebrate sequence entries, part 330.
5298. gbvrt331.seq - Other vertebrate sequence entries, part 331.
5299. gbvrt332.seq - Other vertebrate sequence entries, part 332.
5300. gbvrt333.seq - Other vertebrate sequence entries, part 333.
5301. gbvrt334.seq - Other vertebrate sequence entries, part 334.
5302. gbvrt335.seq - Other vertebrate sequence entries, part 335.
5303. gbvrt34.seq - Other vertebrate sequence entries, part 34.
5304. gbvrt35.seq - Other vertebrate sequence entries, part 35.
5305. gbvrt36.seq - Other vertebrate sequence entries, part 36.
5306. gbvrt37.seq - Other vertebrate sequence entries, part 37.
5307. gbvrt38.seq - Other vertebrate sequence entries, part 38.
5308. gbvrt39.seq - Other vertebrate sequence entries, part 39.
5309. gbvrt4.seq - Other vertebrate sequence entries, part 4.
5310. gbvrt40.seq - Other vertebrate sequence entries, part 40.
5311. gbvrt41.seq - Other vertebrate sequence entries, part 41.
5312. gbvrt42.seq - Other vertebrate sequence entries, part 42.
5313. gbvrt43.seq - Other vertebrate sequence entries, part 43.
5314. gbvrt44.seq - Other vertebrate sequence entries, part 44.
5315. gbvrt45.seq - Other vertebrate sequence entries, part 45.
5316. gbvrt46.seq - Other vertebrate sequence entries, part 46.
5317. gbvrt47.seq - Other vertebrate sequence entries, part 47.
5318. gbvrt48.seq - Other vertebrate sequence entries, part 48.
5319. gbvrt49.seq - Other vertebrate sequence entries, part 49.
5320. gbvrt5.seq - Other vertebrate sequence entries, part 5.
5321. gbvrt50.seq - Other vertebrate sequence entries, part 50.
5322. gbvrt51.seq - Other vertebrate sequence entries, part 51.
5323. gbvrt52.seq - Other vertebrate sequence entries, part 52.
5324. gbvrt53.seq - Other vertebrate sequence entries, part 53.
5325. gbvrt54.seq - Other vertebrate sequence entries, part 54.
5326. gbvrt55.seq - Other vertebrate sequence entries, part 55.
5327. gbvrt56.seq - Other vertebrate sequence entries, part 56.
5328. gbvrt57.seq - Other vertebrate sequence entries, part 57.
5329. gbvrt58.seq - Other vertebrate sequence entries, part 58.
5330. gbvrt59.seq - Other vertebrate sequence entries, part 59.
5331. gbvrt6.seq - Other vertebrate sequence entries, part 6.
5332. gbvrt60.seq - Other vertebrate sequence entries, part 60.
5333. gbvrt61.seq - Other vertebrate sequence entries, part 61.
5334. gbvrt62.seq - Other vertebrate sequence entries, part 62.
5335. gbvrt63.seq - Other vertebrate sequence entries, part 63.
5336. gbvrt64.seq - Other vertebrate sequence entries, part 64.
5337. gbvrt65.seq - Other vertebrate sequence entries, part 65.
5338. gbvrt66.seq - Other vertebrate sequence entries, part 66.
5339. gbvrt67.seq - Other vertebrate sequence entries, part 67.
5340. gbvrt68.seq - Other vertebrate sequence entries, part 68.
5341. gbvrt69.seq - Other vertebrate sequence entries, part 69.
5342. gbvrt7.seq - Other vertebrate sequence entries, part 7.
5343. gbvrt70.seq - Other vertebrate sequence entries, part 70.
5344. gbvrt71.seq - Other vertebrate sequence entries, part 71.
5345. gbvrt72.seq - Other vertebrate sequence entries, part 72.
5346. gbvrt73.seq - Other vertebrate sequence entries, part 73.
5347. gbvrt74.seq - Other vertebrate sequence entries, part 74.
5348. gbvrt75.seq - Other vertebrate sequence entries, part 75.
5349. gbvrt76.seq - Other vertebrate sequence entries, part 76.
5350. gbvrt77.seq - Other vertebrate sequence entries, part 77.
5351. gbvrt78.seq - Other vertebrate sequence entries, part 78.
5352. gbvrt79.seq - Other vertebrate sequence entries, part 79.
5353. gbvrt8.seq - Other vertebrate sequence entries, part 8.
5354. gbvrt80.seq - Other vertebrate sequence entries, part 80.
5355. gbvrt81.seq - Other vertebrate sequence entries, part 81.
5356. gbvrt82.seq - Other vertebrate sequence entries, part 82.
5357. gbvrt83.seq - Other vertebrate sequence entries, part 83.
5358. gbvrt84.seq - Other vertebrate sequence entries, part 84.
5359. gbvrt85.seq - Other vertebrate sequence entries, part 85.
5360. gbvrt86.seq - Other vertebrate sequence entries, part 86.
5361. gbvrt87.seq - Other vertebrate sequence entries, part 87.
5362. gbvrt88.seq - Other vertebrate sequence entries, part 88.
5363. gbvrt89.seq - Other vertebrate sequence entries, part 89.
5364. gbvrt9.seq - Other vertebrate sequence entries, part 9.
5365. gbvrt90.seq - Other vertebrate sequence entries, part 90.
5366. gbvrt91.seq - Other vertebrate sequence entries, part 91.
5367. gbvrt92.seq - Other vertebrate sequence entries, part 92.
5368. gbvrt93.seq - Other vertebrate sequence entries, part 93.
5369. gbvrt94.seq - Other vertebrate sequence entries, part 94.
5370. gbvrt95.seq - Other vertebrate sequence entries, part 95.
5371. gbvrt96.seq - Other vertebrate sequence entries, part 96.
5372. gbvrt97.seq - Other vertebrate sequence entries, part 97.
5373. gbvrt98.seq - Other vertebrate sequence entries, part 98.
5374. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 262.0 flatfiles require roughly 5626 GB,
including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1300187195 gbbct1.seq
1494920342 gbbct10.seq
1490173381 gbbct100.seq
1498881052 gbbct101.seq
397935460 gbbct102.seq
1492628274 gbbct103.seq
372448970 gbbct104.seq
1496847708 gbbct105.seq
721671623 gbbct106.seq
1498272731 gbbct107.seq
185848277 gbbct108.seq
1490155122 gbbct109.seq
632787129 gbbct11.seq
678882882 gbbct110.seq
1492669401 gbbct111.seq
625464854 gbbct112.seq
1490523491 gbbct113.seq
536514463 gbbct114.seq
1491070358 gbbct115.seq
448505664 gbbct116.seq
1496990297 gbbct117.seq
1125413243 gbbct118.seq
1490530099 gbbct119.seq
1491607722 gbbct12.seq
447443024 gbbct120.seq
1499536717 gbbct121.seq
562512248 gbbct122.seq
1497991956 gbbct123.seq
1495061119 gbbct124.seq
771545814 gbbct125.seq
1484728519 gbbct126.seq
414251305 gbbct127.seq
1490750476 gbbct128.seq
468997883 gbbct129.seq
1035954011 gbbct13.seq
1494405796 gbbct130.seq
531174815 gbbct131.seq
1492175241 gbbct132.seq
590454241 gbbct133.seq
1490679638 gbbct134.seq
1489254937 gbbct135.seq
367961744 gbbct136.seq
1495797875 gbbct137.seq
899966862 gbbct138.seq
1498294763 gbbct139.seq
1485503356 gbbct14.seq
922218074 gbbct140.seq
1496611892 gbbct141.seq
1007638068 gbbct142.seq
1493345316 gbbct143.seq
902115737 gbbct144.seq
1499490395 gbbct145.seq
1141504836 gbbct146.seq
1499231508 gbbct147.seq
747719352 gbbct148.seq
1499001224 gbbct149.seq
633355554 gbbct15.seq
1001747042 gbbct150.seq
1498222451 gbbct151.seq
1490829057 gbbct152.seq
865844173 gbbct153.seq
1498776012 gbbct154.seq
1497222141 gbbct155.seq
274102356 gbbct156.seq
1497125673 gbbct157.seq
1046899210 gbbct158.seq
1498387011 gbbct159.seq
1499530744 gbbct16.seq
1496048870 gbbct160.seq
533194999 gbbct161.seq
1489350928 gbbct162.seq
738386261 gbbct163.seq
1491027800 gbbct164.seq
657854122 gbbct165.seq
1498529961 gbbct166.seq
1493582321 gbbct167.seq
730657693 gbbct168.seq
1480016405 gbbct169.seq
989350483 gbbct17.seq
1492358675 gbbct170.seq
533003198 gbbct171.seq
1488708410 gbbct172.seq
1300558107 gbbct173.seq
1496429019 gbbct174.seq
1496613807 gbbct175.seq
315596476 gbbct176.seq
1497524996 gbbct177.seq
1490742714 gbbct178.seq
707383380 gbbct179.seq
1494225724 gbbct18.seq
1491886727 gbbct180.seq
1090367906 gbbct181.seq
1495911281 gbbct182.seq
974620906 gbbct183.seq
1498912698 gbbct184.seq
795071608 gbbct185.seq
1484471221 gbbct186.seq
896830938 gbbct187.seq
1499804343 gbbct188.seq
665481717 gbbct189.seq
637636133 gbbct19.seq
1495144042 gbbct190.seq
514151316 gbbct191.seq
1495326621 gbbct192.seq
1311468007 gbbct193.seq
1496277978 gbbct194.seq
1493204870 gbbct195.seq
316723853 gbbct196.seq
1491509206 gbbct197.seq
579457873 gbbct198.seq
1499470825 gbbct199.seq
393388289 gbbct2.seq
1497607124 gbbct20.seq
471560799 gbbct200.seq
1493504285 gbbct201.seq
1496761902 gbbct202.seq
219408606 gbbct203.seq
1491330340 gbbct204.seq
1436307952 gbbct205.seq
1495174060 gbbct206.seq
711986648 gbbct207.seq
1488468348 gbbct208.seq
561392750 gbbct209.seq
431323253 gbbct21.seq
1493393405 gbbct210.seq
722443682 gbbct211.seq
1497585233 gbbct212.seq
1493646310 gbbct213.seq
291826581 gbbct214.seq
1498979326 gbbct215.seq
1492524373 gbbct216.seq
501938080 gbbct217.seq
1498112499 gbbct218.seq
666665926 gbbct219.seq
1491407780 gbbct22.seq
1487373002 gbbct220.seq
678685495 gbbct221.seq
1491240939 gbbct222.seq
1492339631 gbbct223.seq
688979202 gbbct224.seq
1499235037 gbbct225.seq
1491528190 gbbct226.seq
147315955 gbbct227.seq
1495819625 gbbct228.seq
1200186971 gbbct229.seq
839880629 gbbct23.seq
1492340666 gbbct230.seq
1489152014 gbbct231.seq
213003833 gbbct232.seq
1499470681 gbbct233.seq
832566854 gbbct234.seq
1493440129 gbbct235.seq
1429661414 gbbct236.seq
1495914531 gbbct237.seq
1046050574 gbbct238.seq
1498424639 gbbct239.seq
1497947347 gbbct24.seq
1067705511 gbbct240.seq
1497164566 gbbct241.seq
1495172022 gbbct242.seq
277933089 gbbct243.seq
1493163574 gbbct244.seq
1367307653 gbbct245.seq
1497756028 gbbct246.seq
1494492695 gbbct247.seq
445324933 gbbct248.seq
1495453774 gbbct249.seq
734149997 gbbct25.seq
1347993629 gbbct250.seq
1498946086 gbbct251.seq
788829488 gbbct252.seq
1498455374 gbbct253.seq
816093969 gbbct254.seq
1493792682 gbbct255.seq
499496816 gbbct256.seq
1494989467 gbbct257.seq
605545293 gbbct258.seq
1497012099 gbbct259.seq
1497651318 gbbct26.seq
658647876 gbbct260.seq
1498972629 gbbct261.seq
1104217490 gbbct262.seq
1497030717 gbbct263.seq
938533935 gbbct264.seq
1498737207 gbbct265.seq
1238454089 gbbct266.seq
1489210222 gbbct267.seq
564230255 gbbct268.seq
1494138925 gbbct269.seq
801538861 gbbct27.seq
1042890913 gbbct270.seq
1496045120 gbbct271.seq
1167694449 gbbct272.seq
1490380887 gbbct273.seq
565673882 gbbct274.seq
1496181634 gbbct275.seq
886813463 gbbct276.seq
1495035438 gbbct277.seq
1059442249 gbbct278.seq
1496367291 gbbct279.seq
21439483 gbbct28.seq
1464921705 gbbct280.seq
1498515801 gbbct281.seq
929225517 gbbct282.seq
1492214165 gbbct283.seq
1491975131 gbbct284.seq
621987039 gbbct285.seq
1497198655 gbbct286.seq
1160062406 gbbct287.seq
1498196213 gbbct288.seq
863342560 gbbct289.seq
38705856 gbbct29.seq
1495486456 gbbct290.seq
1495032658 gbbct291.seq
376494284 gbbct292.seq
1492611368 gbbct293.seq
716258457 gbbct294.seq
1497550366 gbbct295.seq
756839506 gbbct296.seq
1491163863 gbbct297.seq
1497527609 gbbct298.seq
196661163 gbbct299.seq
440968736 gbbct3.seq
1494133885 gbbct30.seq
1496589259 gbbct300.seq
1481293783 gbbct301.seq
1499267670 gbbct302.seq
756402359 gbbct303.seq
1494682057 gbbct304.seq
746614063 gbbct305.seq
1491352665 gbbct306.seq
1497959222 gbbct307.seq
235785562 gbbct308.seq
1497713907 gbbct309.seq
480482223 gbbct31.seq
1498515669 gbbct310.seq
663733782 gbbct311.seq
1499618143 gbbct312.seq
1489762250 gbbct313.seq
1498975210 gbbct314.seq
1152570777 gbbct315.seq
1499817988 gbbct316.seq
1385859365 gbbct317.seq
1498414234 gbbct318.seq
497642327 gbbct319.seq
1495481620 gbbct32.seq
1491984507 gbbct320.seq
496313987 gbbct321.seq
1497190149 gbbct322.seq
651635499 gbbct323.seq
1488262665 gbbct324.seq
610803316 gbbct325.seq
1497463106 gbbct326.seq
636389968 gbbct327.seq
1496582329 gbbct328.seq
1155690383 gbbct329.seq
1318993333 gbbct33.seq
1499783162 gbbct330.seq
946349052 gbbct331.seq
1499583302 gbbct332.seq
1499976717 gbbct333.seq
28551574 gbbct334.seq
1476559086 gbbct335.seq
1453669035 gbbct336.seq
1488575393 gbbct337.seq
795442774 gbbct338.seq
1485163835 gbbct339.seq
1491827000 gbbct34.seq
998330304 gbbct340.seq
1498481607 gbbct341.seq
1019169566 gbbct342.seq
1491499388 gbbct343.seq
556367803 gbbct344.seq
1486811205 gbbct345.seq
581524100 gbbct346.seq
1490610259 gbbct347.seq
1343056388 gbbct348.seq
1480116152 gbbct349.seq
1340303157 gbbct35.seq
1224514209 gbbct350.seq
1495132922 gbbct351.seq
916524663 gbbct352.seq
1491702237 gbbct353.seq
1123591601 gbbct354.seq
1490904902 gbbct355.seq
1198803969 gbbct356.seq
1488256186 gbbct357.seq
656429101 gbbct358.seq
1496144270 gbbct359.seq
1481720049 gbbct36.seq
606941691 gbbct360.seq
1496971007 gbbct361.seq
1048782674 gbbct362.seq
1492091082 gbbct363.seq
1498437968 gbbct364.seq
120983575 gbbct365.seq
1499845900 gbbct366.seq
1414469298 gbbct367.seq
1498008202 gbbct368.seq
1272489677 gbbct369.seq
1488663426 gbbct37.seq
1497808992 gbbct370.seq
560939731 gbbct371.seq
1487711273 gbbct372.seq
533776081 gbbct373.seq
1493205003 gbbct374.seq
883260514 gbbct375.seq
1492287925 gbbct376.seq
1488450689 gbbct377.seq
720716656 gbbct378.seq
1499952257 gbbct379.seq
124843461 gbbct38.seq
1447717529 gbbct380.seq
1484153370 gbbct381.seq
1490507719 gbbct382.seq
319071320 gbbct383.seq
1499997413 gbbct384.seq
1495631530 gbbct385.seq
310875051 gbbct386.seq
1494342748 gbbct387.seq
1125312223 gbbct388.seq
1490025661 gbbct389.seq
1499697553 gbbct39.seq
688216522 gbbct390.seq
1497448786 gbbct391.seq
958742317 gbbct392.seq
1498131707 gbbct393.seq
1067620091 gbbct394.seq
1495551921 gbbct395.seq
1499425163 gbbct396.seq
488281438 gbbct397.seq
1490545993 gbbct398.seq
871061625 gbbct399.seq
102364448 gbbct4.seq
1492631339 gbbct40.seq
1497787462 gbbct400.seq
1482319833 gbbct401.seq
1498763501 gbbct402.seq
832751498 gbbct403.seq
1489381885 gbbct404.seq
1181151106 gbbct405.seq
1493545338 gbbct406.seq
710968444 gbbct407.seq
1496003337 gbbct408.seq
1140827205 gbbct409.seq
246524366 gbbct41.seq
1492355305 gbbct410.seq
1229772401 gbbct411.seq
1494247440 gbbct412.seq
1433089244 gbbct413.seq
1493088814 gbbct414.seq
933948517 gbbct415.seq
1499964100 gbbct416.seq
1493088487 gbbct417.seq
953889346 gbbct418.seq
1497442099 gbbct419.seq
1481883826 gbbct42.seq
884998375 gbbct420.seq
1494248351 gbbct421.seq
1498552561 gbbct422.seq
266012759 gbbct423.seq
1490584221 gbbct424.seq
1494778986 gbbct425.seq
583170913 gbbct426.seq
1488601152 gbbct427.seq
732264343 gbbct428.seq
1495719164 gbbct429.seq
957679644 gbbct43.seq
1494120397 gbbct430.seq
113574784 gbbct431.seq
1493036974 gbbct432.seq
669462994 gbbct433.seq
1495805425 gbbct434.seq
701354827 gbbct435.seq
1498722630 gbbct436.seq
796667244 gbbct437.seq
1492118574 gbbct438.seq
700341127 gbbct439.seq
1494893823 gbbct44.seq
1489838257 gbbct440.seq
696799723 gbbct441.seq
1499871640 gbbct442.seq
1494006455 gbbct443.seq
12177142 gbbct444.seq
1497862861 gbbct445.seq
1495508820 gbbct446.seq
139261020 gbbct447.seq
1499070415 gbbct448.seq
1492866033 gbbct449.seq
789309180 gbbct45.seq
143047048 gbbct450.seq
1496202477 gbbct451.seq
721366678 gbbct452.seq
1499993305 gbbct453.seq
1408658845 gbbct454.seq
305005446 gbbct455.seq
6898618 gbbct456.seq
14178210 gbbct457.seq
22823362 gbbct458.seq
44533652 gbbct459.seq
1492617140 gbbct46.seq
86687274 gbbct460.seq
168681895 gbbct461.seq
1496836917 gbbct462.seq
1499997853 gbbct463.seq
123190903 gbbct464.seq
1487453417 gbbct465.seq
709605674 gbbct466.seq
791760668 gbbct467.seq
586091081 gbbct468.seq
626268011 gbbct469.seq
1248491439 gbbct47.seq
544325307 gbbct470.seq
148423328 gbbct471.seq
1134739600 gbbct472.seq
1493448421 gbbct473.seq
1484833134 gbbct474.seq
291905719 gbbct475.seq
1496414509 gbbct476.seq
163883507 gbbct477.seq
1496860173 gbbct478.seq
615755463 gbbct479.seq
1496615283 gbbct48.seq
1499014700 gbbct480.seq
295118892 gbbct481.seq
1493319826 gbbct482.seq
590024546 gbbct483.seq
1492911759 gbbct484.seq
243476185 gbbct485.seq
1499570863 gbbct486.seq
592958022 gbbct487.seq
1494576859 gbbct488.seq
480923903 gbbct489.seq
886059368 gbbct49.seq
51294842 gbbct490.seq
108039002 gbbct491.seq
1422469312 gbbct492.seq
1499948486 gbbct493.seq
1328203277 gbbct494.seq
1493440055 gbbct495.seq
1498373587 gbbct496.seq
133617493 gbbct497.seq
1492246104 gbbct498.seq
619695519 gbbct499.seq
282580177 gbbct5.seq
1496550412 gbbct50.seq
1498283263 gbbct500.seq
437799857 gbbct501.seq
1496629731 gbbct502.seq
506542949 gbbct503.seq
1499998967 gbbct504.seq
268908402 gbbct505.seq
290986411 gbbct51.seq
1492159009 gbbct52.seq
88462798 gbbct53.seq
1496025394 gbbct54.seq
253462586 gbbct55.seq
1498430551 gbbct56.seq
505162037 gbbct57.seq
1495242100 gbbct58.seq
675129841 gbbct59.seq
1497013150 gbbct6.seq
1494190005 gbbct60.seq
499172631 gbbct61.seq
1494455787 gbbct62.seq
330781299 gbbct63.seq
1499126002 gbbct64.seq
492171187 gbbct65.seq
1487505189 gbbct66.seq
1498199893 gbbct67.seq
394473051 gbbct68.seq
1491164687 gbbct69.seq
1023080970 gbbct7.seq
457611102 gbbct70.seq
1492313968 gbbct71.seq
1135423073 gbbct72.seq
1496704412 gbbct73.seq
893416785 gbbct74.seq
1493269352 gbbct75.seq
1412198748 gbbct76.seq
1494061937 gbbct77.seq
1491386462 gbbct78.seq
170803050 gbbct79.seq
1498918813 gbbct8.seq
1496559445 gbbct80.seq
475149026 gbbct81.seq
1491398737 gbbct82.seq
514295883 gbbct83.seq
1492454379 gbbct84.seq
676991923 gbbct85.seq
1497134590 gbbct86.seq
260568507 gbbct87.seq
1492255387 gbbct88.seq
292181906 gbbct89.seq
609385399 gbbct9.seq
1494990751 gbbct90.seq
574348826 gbbct91.seq
1490144676 gbbct92.seq
1212329207 gbbct93.seq
1499838833 gbbct94.seq
763934399 gbbct95.seq
1496833560 gbbct96.seq
748681203 gbbct97.seq
1494274774 gbbct98.seq
937765404 gbbct99.seq
840628 gbchg.txt
1499995891 gbcon1.seq
1499999072 gbcon10.seq
1499994773 gbcon100.seq
594748406 gbcon101.seq
84953982 gbcon11.seq
1498406400 gbcon12.seq
318319660 gbcon13.seq
636023858 gbcon14.seq
126587923 gbcon15.seq
1028310251 gbcon16.seq
1444131052 gbcon17.seq
1500000000 gbcon18.seq
43306374 gbcon19.seq
94251153 gbcon2.seq
1278157868 gbcon20.seq
1271755654 gbcon21.seq
1386617844 gbcon22.seq
1177824385 gbcon23.seq
1240101010 gbcon24.seq
1337030035 gbcon25.seq
1299675944 gbcon26.seq
1261114939 gbcon27.seq
1188545530 gbcon28.seq
1365754855 gbcon29.seq
1498912948 gbcon3.seq
1387263027 gbcon30.seq
973412454 gbcon31.seq
174082386 gbcon32.seq
524545867 gbcon33.seq
704808554 gbcon34.seq
199583073 gbcon35.seq
1014795093 gbcon36.seq
1500000158 gbcon37.seq
81411776 gbcon38.seq
1499447818 gbcon39.seq
552185365 gbcon4.seq
167922947 gbcon40.seq
1139339093 gbcon41.seq
1499999242 gbcon42.seq
271147874 gbcon43.seq
1171037973 gbcon44.seq
1500000132 gbcon45.seq
776544098 gbcon46.seq
1304399113 gbcon47.seq
1133803050 gbcon48.seq
1499998196 gbcon49.seq
1498674263 gbcon5.seq
222371809 gbcon50.seq
1224503700 gbcon51.seq
45938911 gbcon52.seq
1335287226 gbcon53.seq
1499998638 gbcon54.seq
56694018 gbcon55.seq
1245238228 gbcon56.seq
969999009 gbcon57.seq
1250166723 gbcon58.seq
1381733794 gbcon59.seq
1494213635 gbcon6.seq
1183343266 gbcon60.seq
1023833403 gbcon61.seq
1411488563 gbcon62.seq
1380478657 gbcon63.seq
1266881900 gbcon64.seq
1078797150 gbcon65.seq
1499995975 gbcon66.seq
147611220 gbcon67.seq
1499998518 gbcon68.seq
317728349 gbcon69.seq
170068344 gbcon7.seq
1188849419 gbcon70.seq
1499994087 gbcon71.seq
275566165 gbcon72.seq
1499543364 gbcon73.seq
648844765 gbcon74.seq
1130392326 gbcon75.seq
1499998965 gbcon76.seq
298211901 gbcon77.seq
1478756571 gbcon78.seq
1384153930 gbcon79.seq
1499191053 gbcon8.seq
1499997595 gbcon80.seq
140176735 gbcon81.seq
1038927029 gbcon82.seq
1499970544 gbcon83.seq
1326569427 gbcon84.seq
1002939518 gbcon85.seq
1499999806 gbcon86.seq
4740197 gbcon87.seq
1499997185 gbcon88.seq
13882959 gbcon89.seq
1207727405 gbcon9.seq
1499997651 gbcon90.seq
278067584 gbcon91.seq
1499997638 gbcon92.seq
244910751 gbcon93.seq
1499462513 gbcon94.seq
346510000 gbcon95.seq
1499998327 gbcon96.seq
151429954 gbcon97.seq
1499987892 gbcon98.seq
234692153 gbcon99.seq
2358717 gbdel.txt
1499453802 gbenv1.seq
506917977 gbenv10.seq
1192220129 gbenv11.seq
1499999992 gbenv12.seq
85409126 gbenv13.seq
1178762253 gbenv14.seq
1499998347 gbenv15.seq
47233015 gbenv16.seq
1193917273 gbenv17.seq
1336280954 gbenv18.seq
1473193817 gbenv19.seq
15345825 gbenv2.seq
1339462179 gbenv20.seq
1395973334 gbenv21.seq
1347371393 gbenv22.seq
1239595965 gbenv23.seq
1392866171 gbenv24.seq
1500000004 gbenv25.seq
161682059 gbenv26.seq
1499998647 gbenv27.seq
228271332 gbenv28.seq
1316364267 gbenv29.seq
1495179490 gbenv3.seq
1497435236 gbenv30.seq
1499999911 gbenv31.seq
495871023 gbenv32.seq
1496015334 gbenv33.seq
563114560 gbenv34.seq
1499350902 gbenv35.seq
555965397 gbenv36.seq
1498872495 gbenv37.seq
278312076 gbenv38.seq
1499794674 gbenv39.seq
636903293 gbenv4.seq
231529143 gbenv40.seq
1499184984 gbenv5.seq
1499999650 gbenv6.seq
537435380 gbenv7.seq
1055754424 gbenv8.seq
1500000147 gbenv9.seq
1499998040 gbest1.seq
1244464797 gbest10.seq
478415744 gbest100.seq
1499997280 gbest101.seq
462325791 gbest102.seq
1499999379 gbest103.seq
495993472 gbest104.seq
1499998126 gbest105.seq
527381702 gbest106.seq
1497312411 gbest107.seq
1499999347 gbest108.seq
521629824 gbest109.seq
1499997341 gbest11.seq
1499998761 gbest110.seq
577517209 gbest111.seq
1499997156 gbest112.seq
515370117 gbest113.seq
1499997632 gbest114.seq
561280486 gbest115.seq
1499996889 gbest116.seq
122791102 gbest117.seq
1499997186 gbest118.seq
554824720 gbest119.seq
549178688 gbest12.seq
1499999315 gbest120.seq
557312649 gbest121.seq
1499999336 gbest122.seq
513962811 gbest123.seq
1499999122 gbest124.seq
525515408 gbest125.seq
1487301474 gbest126.seq
1499997487 gbest127.seq
506538979 gbest128.seq
1499998898 gbest129.seq
1499998260 gbest13.seq
508766467 gbest130.seq
1499997805 gbest131.seq
425307183 gbest132.seq
1499997662 gbest133.seq
502239515 gbest134.seq
1469762523 gbest135.seq
1499999386 gbest136.seq
541305620 gbest137.seq
1499999458 gbest138.seq
495006349 gbest139.seq
487385592 gbest14.seq
1499999012 gbest140.seq
557704401 gbest141.seq
1499998388 gbest142.seq
469754446 gbest143.seq
1499998627 gbest144.seq
519798159 gbest145.seq
993963355 gbest146.seq
1499999735 gbest147.seq
507254809 gbest148.seq
1499999135 gbest149.seq
1500000005 gbest15.seq
447101855 gbest150.seq
1499998952 gbest151.seq
386059425 gbest152.seq
1499999162 gbest153.seq
523821485 gbest154.seq
1499998996 gbest155.seq
561909274 gbest156.seq
166258344 gbest157.seq
1499996978 gbest158.seq
588313945 gbest159.seq
466305343 gbest16.seq
1499998470 gbest160.seq
668167614 gbest161.seq
1499996792 gbest162.seq
656073978 gbest163.seq
1499999457 gbest164.seq
496990696 gbest165.seq
1499999246 gbest166.seq
68571975 gbest167.seq
1499997309 gbest168.seq
584876141 gbest169.seq
1499998232 gbest17.seq
1499998562 gbest170.seq
588497899 gbest171.seq
1499998506 gbest172.seq
549399541 gbest173.seq
1499998583 gbest174.seq
589133348 gbest175.seq
1499995926 gbest176.seq
624829775 gbest177.seq
828529101 gbest178.seq
1500000164 gbest179.seq
691425682 gbest18.seq
560913835 gbest180.seq
1499999145 gbest181.seq
410568558 gbest182.seq
1335975617 gbest183.seq
1261733551 gbest184.seq
1457029314 gbest185.seq
1305524688 gbest186.seq
1336201281 gbest187.seq
1188592078 gbest188.seq
1120643618 gbest189.seq
1499999283 gbest19.seq
1161929695 gbest190.seq
1146695156 gbest191.seq
1499997719 gbest192.seq
500797842 gbest193.seq
1499999707 gbest194.seq
523700291 gbest195.seq
170019681 gbest196.seq
1499997341 gbest197.seq
528584856 gbest198.seq
1499998162 gbest199.seq
434903673 gbest2.seq
689546565 gbest20.seq
569247428 gbest200.seq
1499998543 gbest201.seq
558919353 gbest202.seq
1499997106 gbest203.seq
537209121 gbest204.seq
1499999584 gbest205.seq
574408016 gbest206.seq
1500000073 gbest207.seq
208386269 gbest208.seq
1499999236 gbest209.seq
1499999625 gbest21.seq
595444763 gbest210.seq
1499997620 gbest211.seq
557673476 gbest212.seq
1499993891 gbest213.seq
644690195 gbest214.seq
1499998771 gbest215.seq
644817191 gbest216.seq
1499999663 gbest217.seq
520861078 gbest218.seq
174271459 gbest219.seq
477158612 gbest22.seq
1086399495 gbest220.seq
1076881402 gbest221.seq
1499997622 gbest222.seq
600064016 gbest223.seq
1499998945 gbest224.seq
511158642 gbest225.seq
1499999387 gbest226.seq
478133188 gbest227.seq
1499998503 gbest228.seq
418637193 gbest229.seq
856636822 gbest23.seq
1499998117 gbest230.seq
583428041 gbest231.seq
1499997412 gbest232.seq
533027091 gbest233.seq
1499996728 gbest234.seq
544540944 gbest235.seq
1499998885 gbest236.seq
512071295 gbest237.seq
1393266588 gbest238.seq
1112508450 gbest239.seq
1499999626 gbest24.seq
1050519718 gbest240.seq
1500000059 gbest241.seq
794337576 gbest242.seq
483951171 gbest25.seq
1499998323 gbest26.seq
464571928 gbest27.seq
1499997150 gbest28.seq
507928337 gbest29.seq
1499998962 gbest3.seq
1499998089 gbest30.seq
484338089 gbest31.seq
1500000131 gbest32.seq
510470916 gbest33.seq
123414980 gbest34.seq
1499999833 gbest35.seq
506602527 gbest36.seq
1499996098 gbest37.seq
547335606 gbest38.seq
1499997418 gbest39.seq
469427397 gbest4.seq
554021191 gbest40.seq
1499997650 gbest41.seq
472376852 gbest42.seq
1499995810 gbest43.seq
500148457 gbest44.seq
35244903 gbest45.seq
1499997434 gbest46.seq
527797150 gbest47.seq
1499999919 gbest48.seq
509963450 gbest49.seq
1499997295 gbest5.seq
1499999092 gbest50.seq
521819732 gbest51.seq
1499999782 gbest52.seq
18202008 gbest53.seq
1500000156 gbest54.seq
69236135 gbest55.seq
1223774214 gbest56.seq
1195302920 gbest57.seq
1499996399 gbest58.seq
585312182 gbest59.seq
475313040 gbest6.seq
1499999280 gbest60.seq
604746137 gbest61.seq
1500000230 gbest62.seq
529223178 gbest63.seq
1499999915 gbest64.seq
532286301 gbest65.seq
1499999964 gbest66.seq
324553779 gbest67.seq
1499996680 gbest68.seq
526476819 gbest69.seq
750171237 gbest7.seq
1499997910 gbest70.seq
511189562 gbest71.seq
1499998394 gbest72.seq
586540280 gbest73.seq
1499998278 gbest74.seq
620380874 gbest75.seq
1499997465 gbest76.seq
565990987 gbest77.seq
903618988 gbest78.seq
1499996645 gbest79.seq
1421196661 gbest8.seq
542967096 gbest80.seq
1499997615 gbest81.seq
542872065 gbest82.seq
1499999368 gbest83.seq
511797490 gbest84.seq
1499999709 gbest85.seq
529959228 gbest86.seq
1500000254 gbest87.seq
534304138 gbest88.seq
13610370 gbest89.seq
1262978647 gbest9.seq
1329304053 gbest90.seq
1321738198 gbest91.seq
1267561364 gbest92.seq
1270177843 gbest93.seq
1499997704 gbest94.seq
552168119 gbest95.seq
1500000032 gbest96.seq
547762830 gbest97.seq
1176619908 gbest98.seq
1499997739 gbest99.seq
1499998384 gbgss1.seq
1499998924 gbgss10.seq
6147876 gbgss100.seq
1499999483 gbgss101.seq
264587590 gbgss102.seq
1499998544 gbgss103.seq
429620282 gbgss104.seq
1499999258 gbgss105.seq
471953405 gbgss106.seq
1499999910 gbgss107.seq
419754980 gbgss108.seq
1499997195 gbgss109.seq
549831935 gbgss11.seq
518244381 gbgss110.seq
315572447 gbgss111.seq
1499999898 gbgss112.seq
467315305 gbgss113.seq
1499998567 gbgss114.seq
536130050 gbgss115.seq
1499997700 gbgss116.seq
522038817 gbgss117.seq
1499998777 gbgss118.seq
1959679 gbgss119.seq
1499999070 gbgss12.seq
1499999188 gbgss120.seq
499937285 gbgss121.seq
1477073826 gbgss122.seq
531343383 gbgss13.seq
1499998944 gbgss14.seq
475326860 gbgss15.seq
1499997653 gbgss16.seq
512509603 gbgss17.seq
1169371977 gbgss18.seq
1499999518 gbgss19.seq
541483221 gbgss2.seq
488261995 gbgss20.seq
1499998175 gbgss21.seq
444354605 gbgss22.seq
1499999209 gbgss23.seq
421053044 gbgss24.seq
1499998638 gbgss25.seq
428187797 gbgss26.seq
67726427 gbgss27.seq
1500000018 gbgss28.seq
492467696 gbgss29.seq
1499999187 gbgss3.seq
1499997714 gbgss30.seq
502766774 gbgss31.seq
1499999580 gbgss32.seq
419366282 gbgss33.seq
1499997062 gbgss34.seq
34855955 gbgss35.seq
1499998229 gbgss36.seq
493097614 gbgss37.seq
1499998349 gbgss38.seq
507406752 gbgss39.seq
555795271 gbgss4.seq
1499999418 gbgss40.seq
534174148 gbgss41.seq
1499999956 gbgss42.seq
465182812 gbgss43.seq
244248654 gbgss44.seq
1499997597 gbgss45.seq
545807577 gbgss46.seq
1500000010 gbgss47.seq
468704724 gbgss48.seq
1499997891 gbgss49.seq
1499999481 gbgss5.seq
542612344 gbgss50.seq
1499996778 gbgss51.seq
319648283 gbgss52.seq
1499997389 gbgss53.seq
605483733 gbgss54.seq
1499999917 gbgss55.seq
509083021 gbgss56.seq
1499998603 gbgss57.seq
451766711 gbgss58.seq
1499998515 gbgss59.seq
504873918 gbgss6.seq
529780376 gbgss60.seq
709677252 gbgss61.seq
1499997150 gbgss62.seq
514831545 gbgss63.seq
1499997106 gbgss64.seq
516779569 gbgss65.seq
1499997356 gbgss66.seq
502038098 gbgss67.seq
1499997413 gbgss68.seq
506828983 gbgss69.seq
1499999123 gbgss7.seq
373345547 gbgss70.seq
1499998958 gbgss71.seq
456782348 gbgss72.seq
1499999602 gbgss73.seq
458341813 gbgss74.seq
1499998619 gbgss75.seq
456856216 gbgss76.seq
1499999199 gbgss77.seq
364170445 gbgss78.seq
1215813619 gbgss79.seq
483126587 gbgss8.seq
1068461944 gbgss80.seq
1499999007 gbgss81.seq
549668532 gbgss82.seq
1499999044 gbgss83.seq
541154416 gbgss84.seq
1057630775 gbgss85.seq
1499998892 gbgss86.seq
496080781 gbgss87.seq
1499999252 gbgss88.seq
556326282 gbgss89.seq
826435324 gbgss9.seq
1499998508 gbgss90.seq
480966011 gbgss91.seq
1055215094 gbgss92.seq
1499998172 gbgss93.seq
483143456 gbgss94.seq
1499997645 gbgss95.seq
487712323 gbgss96.seq
1499998457 gbgss97.seq
475204364 gbgss98.seq
1499998809 gbgss99.seq
1499996974 gbhtc1.seq
331477785 gbhtc2.seq
940147588 gbhtc3.seq
715442870 gbhtc4.seq
1499970679 gbhtg1.seq
983521005 gbhtg10.seq
1267922281 gbhtg11.seq
1224694958 gbhtg12.seq
1265374181 gbhtg13.seq
1222998561 gbhtg14.seq
1234738882 gbhtg15.seq
1201837478 gbhtg16.seq
1205529983 gbhtg17.seq
1193774332 gbhtg18.seq
1161238777 gbhtg19.seq
1002667041 gbhtg2.seq
1252750271 gbhtg20.seq
1499956575 gbhtg21.seq
167070977 gbhtg22.seq
1499895799 gbhtg23.seq
468416937 gbhtg24.seq
1499942271 gbhtg25.seq
1417599475 gbhtg26.seq
1384967615 gbhtg27.seq
1383479100 gbhtg28.seq
1499949743 gbhtg29.seq
1499664910 gbhtg3.seq
1307517799 gbhtg30.seq
985106521 gbhtg4.seq
1499788780 gbhtg5.seq
974339154 gbhtg6.seq
1499819223 gbhtg7.seq
972858044 gbhtg8.seq
1499902742 gbhtg9.seq
1500000130 gbinv1.seq
94381501 gbinv10.seq
1182054227 gbinv100.seq
1386518936 gbinv1000.se
592071448 gbinv1001.se
1478483619 gbinv1002.se
530982066 gbinv1003.se
1462302633 gbinv1004.se
1488222098 gbinv1005.se
316978161 gbinv1006.se
1428447642 gbinv1007.se
748970586 gbinv1008.se
1447037924 gbinv1009.se
1499663243 gbinv101.seq
497131956 gbinv1010.se
1476470436 gbinv1011.se
723654522 gbinv1012.se
1488497897 gbinv1013.se
776269438 gbinv1014.se
1401070087 gbinv1015.se
1499767191 gbinv1016.se
26774817 gbinv1017.se
1374498134 gbinv1018.se
839509523 gbinv1019.se
133410444 gbinv102.seq
1429054226 gbinv1020.se
511579884 gbinv1021.se
1499769508 gbinv1022.se
285714929 gbinv1023.se
1488663552 gbinv1024.se
852471186 gbinv1025.se
1497639222 gbinv1026.se
940269075 gbinv1027.se
1372239390 gbinv1028.se
883953960 gbinv1029.se
548623487 gbinv103.seq
1414834225 gbinv1030.se
950346640 gbinv1031.se
1420677910 gbinv1032.se
1484572405 gbinv1033.se
302207567 gbinv1034.se
1471402527 gbinv1035.se
242824332 gbinv1036.se
1486519935 gbinv1037.se
516118654 gbinv1038.se
1443896344 gbinv1039.se
1489473163 gbinv104.seq
401590756 gbinv1040.se
1482551138 gbinv1041.se
379825603 gbinv1042.se
1471607599 gbinv1043.se
627240431 gbinv1044.se
1483677454 gbinv1045.se
534260145 gbinv1046.se
1470409794 gbinv1047.se
815630388 gbinv1048.se
1439612217 gbinv1049.se
510289823 gbinv105.seq
634137125 gbinv1050.se
1476799939 gbinv1051.se
690990472 gbinv1052.se
1446569710 gbinv1053.se
586322661 gbinv1054.se
1395031330 gbinv1055.se
705605596 gbinv1056.se
1433843315 gbinv1057.se
1481381148 gbinv1058.se
1499117349 gbinv1059.se
1499621237 gbinv106.seq
1497681677 gbinv1060.se
1372784832 gbinv1061.se
1479685759 gbinv1062.se
230078798 gbinv1063.se
1447125165 gbinv1064.se
1453467490 gbinv1065.se
206238518 gbinv1066.se
1487439186 gbinv1067.se
1224203052 gbinv1068.se
1357832111 gbinv1069.se
1479771613 gbinv107.seq
1403389078 gbinv1070.se
656055076 gbinv1071.se
1121741672 gbinv1072.se
1368086883 gbinv1073.se
686317202 gbinv1074.se
1399135479 gbinv1075.se
821660257 gbinv1076.se
1397635788 gbinv1077.se
816142192 gbinv1078.se
1446639443 gbinv1079.se
305143352 gbinv108.seq
645739583 gbinv1080.se
1390811119 gbinv1081.se
1064243921 gbinv1082.se
1488109643 gbinv1083.se
923527557 gbinv1084.se
1481325909 gbinv1085.se
697722209 gbinv1086.se
1475479562 gbinv1087.se
719219337 gbinv1088.se
1497988716 gbinv1089.se
933854214 gbinv109.seq
740347874 gbinv1090.se
1467945547 gbinv1091.se
692481418 gbinv1092.se
1486662468 gbinv1093.se
816526791 gbinv1094.se
1489622580 gbinv1095.se
748227967 gbinv1096.se
1453258729 gbinv1097.se
814712699 gbinv1098.se
1498977172 gbinv1099.se
1497689770 gbinv11.seq
1488026360 gbinv110.seq
718683040 gbinv1100.se
1479388746 gbinv1101.se
804290078 gbinv1102.se
1376311099 gbinv1103.se
823978155 gbinv1104.se
1398762941 gbinv1105.se
857690114 gbinv1106.se
1487617102 gbinv1107.se
695807854 gbinv1108.se
1465110886 gbinv1109.se
1271327187 gbinv111.seq
915542243 gbinv1110.se
1351412270 gbinv1111.se
852785046 gbinv1112.se
1496576890 gbinv1113.se
899922817 gbinv1114.se
1470875468 gbinv1115.se
750692912 gbinv1116.se
1451930781 gbinv1117.se
792296062 gbinv1118.se
1445905314 gbinv1119.se
1479772341 gbinv112.seq
909284606 gbinv1120.se
1492945181 gbinv1121.se
994391157 gbinv1122.se
1444484845 gbinv1123.se
720432610 gbinv1124.se
1286750492 gbinv1125.se
1088038076 gbinv1126.se
1410592267 gbinv1127.se
977887893 gbinv1128.se
1441593194 gbinv1129.se
1340183057 gbinv113.seq
968609751 gbinv1130.se
1492573925 gbinv1131.se
749926216 gbinv1132.se
1491389704 gbinv1133.se
789510055 gbinv1134.se
1385270631 gbinv1135.se
1037388001 gbinv1136.se
1392955002 gbinv1137.se
854428789 gbinv1138.se
1499959282 gbinv114.seq
1329791463 gbinv115.seq
1462835389 gbinv116.seq
1384398530 gbinv117.seq
1497744691 gbinv118.seq
1308739356 gbinv119.seq
613722125 gbinv12.seq
1480253815 gbinv120.seq
1356395603 gbinv121.seq
1465230120 gbinv122.seq
1346183566 gbinv123.seq
1483867182 gbinv124.seq
709054487 gbinv125.seq
1481355114 gbinv126.seq
1099028683 gbinv127.seq
1467670433 gbinv128.seq
1431393152 gbinv129.seq
1484460112 gbinv13.seq
1398300529 gbinv130.seq
1236085404 gbinv131.seq
1290961000 gbinv132.seq
1407794472 gbinv133.seq
1499688291 gbinv134.seq
858170497 gbinv135.seq
1394266063 gbinv136.seq
1499862021 gbinv137.seq
262234281 gbinv138.seq
1499966002 gbinv139.seq
1472044257 gbinv14.seq
218517075 gbinv140.seq
1499976501 gbinv141.seq
349146665 gbinv142.seq
1499821219 gbinv143.seq
1066916793 gbinv144.seq
1499934027 gbinv145.seq
566131542 gbinv146.seq
1499930839 gbinv147.seq
1122240846 gbinv148.seq
1468682724 gbinv149.seq
252009079 gbinv15.seq
1499999519 gbinv150.seq
89706920 gbinv151.seq
1499999052 gbinv152.seq
1135268168 gbinv153.seq
1499997976 gbinv154.seq
63545965 gbinv155.seq
1499998950 gbinv156.seq
750880137 gbinv157.seq
1234792748 gbinv158.seq
1127903322 gbinv159.seq
1411212874 gbinv16.seq
1370092189 gbinv160.seq
1071522534 gbinv161.seq
1491749892 gbinv162.seq
1482077488 gbinv163.seq
1428486102 gbinv164.seq
785387038 gbinv165.seq
1485746848 gbinv166.seq
950447013 gbinv167.seq
1496705944 gbinv168.seq
806848727 gbinv169.seq
472455130 gbinv17.seq
1493872622 gbinv170.seq
856340119 gbinv171.seq
1495116171 gbinv172.seq
830173484 gbinv173.seq
1462548683 gbinv174.seq
909175094 gbinv175.seq
1497255008 gbinv176.seq
948159065 gbinv177.seq
1168251683 gbinv178.seq
1001728647 gbinv179.seq
1463087102 gbinv18.seq
1484591726 gbinv180.seq
818944818 gbinv181.seq
1365196578 gbinv182.seq
656430488 gbinv183.seq
1469549148 gbinv184.seq
304494269 gbinv185.seq
1465424531 gbinv186.seq
326171717 gbinv187.seq
1481915194 gbinv188.seq
280017103 gbinv189.seq
382893064 gbinv19.seq
1461126854 gbinv190.seq
363343781 gbinv191.seq
1485699469 gbinv192.seq
492580334 gbinv193.seq
1484074546 gbinv194.seq
116340814 gbinv195.seq
1495860854 gbinv196.seq
1302209762 gbinv197.seq
1494942690 gbinv198.seq
1230663377 gbinv199.seq
1329139140 gbinv2.seq
1491326951 gbinv20.seq
1476437097 gbinv200.seq
444097657 gbinv201.seq
1475045916 gbinv202.seq
476777023 gbinv203.seq
1498005845 gbinv204.seq
1493093103 gbinv205.seq
30575344 gbinv206.seq
1498741126 gbinv207.seq
1488696868 gbinv208.seq
1451061108 gbinv209.seq
478394243 gbinv21.seq
1433437455 gbinv210.seq
262703171 gbinv211.seq
1491835196 gbinv212.seq
572555681 gbinv213.seq
1486458372 gbinv214.seq
1488217107 gbinv215.seq
1490465641 gbinv216.seq
1126350077 gbinv217.seq
1450277543 gbinv218.seq
1319901770 gbinv219.seq
1499969093 gbinv22.seq
1347201702 gbinv220.seq
1495706167 gbinv221.seq
421394198 gbinv222.seq
1469684916 gbinv223.seq
1112043464 gbinv224.seq
1495036534 gbinv225.seq
569557824 gbinv226.seq
1488360125 gbinv227.seq
678444187 gbinv228.seq
1478247791 gbinv229.seq
1121660607 gbinv23.seq
1499359194 gbinv230.seq
31554185 gbinv231.seq
1490085879 gbinv232.seq
1437458515 gbinv233.seq
72193350 gbinv234.seq
1498596856 gbinv235.seq
1144961759 gbinv236.seq
1146698377 gbinv237.seq
1036956058 gbinv238.seq
544459581 gbinv239.seq
1474452321 gbinv24.seq
1439602775 gbinv240.seq
1414400959 gbinv241.seq
216067261 gbinv242.seq
1474729500 gbinv243.seq
462939038 gbinv244.seq
1490427003 gbinv245.seq
571039519 gbinv246.seq
1485366449 gbinv247.seq
1448567597 gbinv248.seq
102290543 gbinv249.seq
1480929712 gbinv25.seq
1489524458 gbinv250.seq
512699050 gbinv251.seq
1395656265 gbinv252.seq
353041445 gbinv253.seq
1475607229 gbinv254.seq
367023446 gbinv255.seq
1498739195 gbinv256.seq
532000359 gbinv257.seq
1463905811 gbinv258.seq
342931318 gbinv259.seq
133188059 gbinv26.seq
1334667769 gbinv260.seq
538071589 gbinv261.seq
1485299655 gbinv262.seq
1082764780 gbinv263.seq
1440782442 gbinv264.seq
1136943111 gbinv265.seq
1495736706 gbinv266.seq
961513285 gbinv267.seq
1488706132 gbinv268.seq
421826050 gbinv269.seq
1449149144 gbinv27.seq
1417643381 gbinv270.seq
628806708 gbinv271.seq
1495082612 gbinv272.seq
562813715 gbinv273.seq
1337955552 gbinv274.seq
316192878 gbinv275.seq
1480026370 gbinv276.seq
532334004 gbinv277.seq
1411065540 gbinv278.seq
358679242 gbinv279.seq
192334243 gbinv28.seq
1429898216 gbinv280.seq
513013670 gbinv281.seq
1489350842 gbinv282.seq
334664659 gbinv283.seq
1492745138 gbinv284.seq
459659257 gbinv285.seq
1488662358 gbinv286.seq
329960301 gbinv287.seq
1498430713 gbinv288.seq
732438165 gbinv289.seq
1484791811 gbinv29.seq
1439672263 gbinv290.seq
856718137 gbinv291.seq
1494030148 gbinv292.seq
746097843 gbinv293.seq
1461000022 gbinv294.seq
831048648 gbinv295.seq
1414274849 gbinv296.seq
743540755 gbinv297.seq
1442985378 gbinv298.seq
1032623400 gbinv299.seq
1395011208 gbinv3.seq
416869708 gbinv30.seq
1449037838 gbinv300.seq
780441251 gbinv301.seq
1376944968 gbinv302.seq
347219848 gbinv303.seq
1484503489 gbinv304.seq
326435281 gbinv305.seq
1466419199 gbinv306.seq
282550709 gbinv307.seq
1481213432 gbinv308.seq
258304685 gbinv309.seq
1464142701 gbinv31.seq
1277131227 gbinv310.seq
321246481 gbinv311.seq
1385396260 gbinv312.seq
1369192781 gbinv313.seq
355690685 gbinv314.seq
1334142726 gbinv315.seq
1470257963 gbinv316.seq
509392891 gbinv317.seq
1484501940 gbinv318.seq
1358747502 gbinv319.seq
421068898 gbinv32.seq
312842405 gbinv320.seq
1421658161 gbinv321.seq
1476020704 gbinv322.seq
353309462 gbinv323.seq
1484355892 gbinv324.seq
1489535757 gbinv325.seq
124238895 gbinv326.seq
1352328131 gbinv327.seq
436474776 gbinv328.seq
1496458691 gbinv329.seq
1486507586 gbinv33.seq
713914519 gbinv330.seq
1439419495 gbinv331.seq
1197396451 gbinv332.seq
1495699303 gbinv333.seq
198554656 gbinv334.seq
1430730340 gbinv335.seq
1100445017 gbinv336.seq
1492366474 gbinv337.seq
586627743 gbinv338.seq
1471256820 gbinv339.seq
234808981 gbinv34.seq
1430049479 gbinv340.seq
346088777 gbinv341.seq
1442141266 gbinv342.seq
1446928519 gbinv343.seq
413523689 gbinv344.seq
1405608717 gbinv345.seq
640456621 gbinv346.seq
1240136015 gbinv347.seq
824225634 gbinv348.seq
1498393137 gbinv349.seq
1496624930 gbinv35.seq
542931472 gbinv350.seq
1491758087 gbinv351.seq
415614640 gbinv352.seq
1407782754 gbinv353.seq
500660668 gbinv354.seq
1443611809 gbinv355.seq
674031425 gbinv356.seq
1479938154 gbinv357.seq
1223421144 gbinv358.seq
1393719787 gbinv359.seq
204078060 gbinv36.seq
1482861531 gbinv360.seq
1479953476 gbinv361.seq
1209325387 gbinv362.seq
357962786 gbinv363.seq
1478381690 gbinv364.seq
421175954 gbinv365.seq
1447728294 gbinv366.seq
601914982 gbinv367.seq
1377783156 gbinv368.seq
902573572 gbinv369.seq
1478381151 gbinv37.seq
1426894153 gbinv370.seq
879778924 gbinv371.seq
1456066923 gbinv372.seq
1485824143 gbinv373.seq
141189064 gbinv374.seq
1472791262 gbinv375.seq
1442050951 gbinv376.seq
62656836 gbinv377.seq
1332945717 gbinv378.seq
1388892442 gbinv379.seq
277391075 gbinv38.seq
263791263 gbinv380.seq
1472556828 gbinv381.seq
1161993956 gbinv382.seq
1496224837 gbinv383.seq
1136721010 gbinv384.seq
1351507764 gbinv385.seq
1212772183 gbinv386.seq
1478983332 gbinv387.seq
1285994500 gbinv388.seq
1397715201 gbinv389.seq
1476172723 gbinv39.seq
982484040 gbinv390.seq
1471745710 gbinv391.seq
1469784460 gbinv392.seq
1490304786 gbinv393.seq
1139848900 gbinv394.seq
1459727733 gbinv395.seq
1406579342 gbinv396.seq
299175085 gbinv397.seq
1440324771 gbinv398.seq
634804122 gbinv399.seq
448191300 gbinv4.seq
241897360 gbinv40.seq
1476156793 gbinv400.seq
583773776 gbinv401.seq
1439439559 gbinv402.seq
590897802 gbinv403.seq
869432927 gbinv404.seq
2729769834 gbinv405.seq
1951209797 gbinv406.seq
1255792905 gbinv407.seq
898357564 gbinv408.seq
708100575 gbinv409.seq
1490840269 gbinv41.seq
1285990042 gbinv410.seq
862289027 gbinv411.seq
1443272573 gbinv412.seq
530056032 gbinv413.seq
1455700870 gbinv414.seq
289519034 gbinv415.seq
1496990721 gbinv416.seq
400324666 gbinv417.seq
1484025346 gbinv418.seq
234725199 gbinv419.seq
247566661 gbinv42.seq
1496745524 gbinv420.seq
219755877 gbinv421.seq
1473176550 gbinv422.seq
250139837 gbinv423.seq
1490216426 gbinv424.seq
245438038 gbinv425.seq
1421504392 gbinv426.seq
389948490 gbinv427.seq
1456740438 gbinv428.seq
332242654 gbinv429.seq
1483209265 gbinv43.seq
1495130891 gbinv430.seq
323405403 gbinv431.seq
1490655527 gbinv432.seq
314601722 gbinv433.seq
1485311445 gbinv434.seq
487095099 gbinv435.seq
1477554828 gbinv436.seq
615885650 gbinv437.seq
1493130408 gbinv438.seq
530737214 gbinv439.seq
247826516 gbinv44.seq
1497402423 gbinv440.seq
496766028 gbinv441.seq
1388528914 gbinv442.seq
382943701 gbinv443.seq
1377089717 gbinv444.seq
466011910 gbinv445.seq
1486110854 gbinv446.seq
345122102 gbinv447.seq
1485700745 gbinv448.seq
371367831 gbinv449.seq
1454074717 gbinv45.seq
1490043094 gbinv450.seq
289247942 gbinv451.seq
1428729976 gbinv452.seq
461978251 gbinv453.seq
1456581853 gbinv454.seq
126003479 gbinv455.seq
1480297042 gbinv456.seq
659311954 gbinv457.seq
1483437625 gbinv458.seq
586388071 gbinv459.seq
308472259 gbinv46.seq
1434897706 gbinv460.seq
660034729 gbinv461.seq
1485826608 gbinv462.seq
603779440 gbinv463.seq
1479700425 gbinv464.seq
565812317 gbinv465.seq
1493710702 gbinv466.seq
594270540 gbinv467.seq
1463114920 gbinv468.seq
961101608 gbinv469.seq
1332046634 gbinv47.seq
1468567869 gbinv470.seq
305294342 gbinv471.seq
1490770719 gbinv472.seq
876126175 gbinv473.seq
1485474619 gbinv474.seq
864451948 gbinv475.seq
1491363203 gbinv476.seq
866828741 gbinv477.seq
1340897041 gbinv478.seq
1497646503 gbinv479.seq
1030101320 gbinv48.seq
258588435 gbinv480.seq
1491648578 gbinv481.seq
422460477 gbinv482.seq
1469557945 gbinv483.seq
583322803 gbinv484.seq
1473586952 gbinv485.seq
512626556 gbinv486.seq
1484985659 gbinv487.seq
475110570 gbinv488.seq
1460025895 gbinv489.seq
1278053548 gbinv49.seq
480742216 gbinv490.seq
1418812379 gbinv491.seq
564645002 gbinv492.seq
1471722405 gbinv493.seq
546679836 gbinv494.seq
1464315366 gbinv495.seq
1488596506 gbinv496.seq
33427006 gbinv497.seq
1482877481 gbinv498.seq
1490889124 gbinv499.seq
1499533078 gbinv5.seq
650487144 gbinv50.seq
90441378 gbinv500.seq
1476477408 gbinv501.seq
480868562 gbinv502.seq
1464325796 gbinv503.seq
1338568836 gbinv504.seq
480059394 gbinv505.seq
1496895763 gbinv506.seq
342037518 gbinv507.seq
1484204605 gbinv508.seq
583980876 gbinv509.seq
1479054590 gbinv51.seq
1483484812 gbinv510.seq
433456206 gbinv511.seq
1498027089 gbinv512.seq
871379341 gbinv513.seq
1474039476 gbinv514.seq
920098493 gbinv515.seq
1484696408 gbinv516.seq
837001192 gbinv517.seq
1474790353 gbinv518.seq
971677762 gbinv519.seq
395398421 gbinv52.seq
1488358577 gbinv520.seq
988576390 gbinv521.seq
1493913751 gbinv522.seq
1337790154 gbinv523.seq
1482674926 gbinv524.seq
1393357388 gbinv525.seq
1483083030 gbinv526.seq
1347199508 gbinv527.seq
1390153087 gbinv528.seq
746496786 gbinv529.seq
1498186435 gbinv53.seq
1405110366 gbinv530.seq
490736101 gbinv531.seq
1495749208 gbinv532.seq
622207073 gbinv533.seq
1477768331 gbinv534.seq
442461420 gbinv535.seq
1496013057 gbinv536.seq
688690731 gbinv537.seq
1470664484 gbinv538.seq
735441637 gbinv539.seq
804909390 gbinv54.seq
1476090858 gbinv540.seq
674365936 gbinv541.seq
1473275233 gbinv542.seq
693591870 gbinv543.seq
1487352246 gbinv544.seq
349494731 gbinv545.seq
1490482586 gbinv546.seq
357339548 gbinv547.seq
1490279069 gbinv548.seq
380118841 gbinv549.seq
1489731441 gbinv55.seq
1482629494 gbinv550.seq
463916298 gbinv551.seq
1499586214 gbinv552.seq
876874119 gbinv553.seq
1489968687 gbinv554.seq
880061477 gbinv555.seq
1483044191 gbinv556.seq
1445615250 gbinv557.seq
403386358 gbinv558.seq
1426566075 gbinv559.seq
1203699553 gbinv56.seq
1496817860 gbinv560.seq
223857543 gbinv561.seq
1483084573 gbinv562.seq
1474052588 gbinv563.seq
1471567223 gbinv564.seq
277662519 gbinv565.seq
1490877824 gbinv566.seq
234260561 gbinv567.seq
1397325934 gbinv568.seq
256237162 gbinv569.seq
907414418 gbinv57.seq
1466164356 gbinv570.seq
1480718563 gbinv571.seq
357065534 gbinv572.seq
1402593345 gbinv573.seq
417293984 gbinv574.seq
1477814635 gbinv575.seq
508922492 gbinv576.seq
1483472015 gbinv577.seq
307039761 gbinv578.seq
1481273614 gbinv579.seq
1490935388 gbinv58.seq
296798815 gbinv580.seq
1486500129 gbinv581.seq
298302504 gbinv582.seq
1341735347 gbinv583.seq
397549581 gbinv584.seq
1412631682 gbinv585.seq
337603338 gbinv586.seq
1486261599 gbinv587.seq
284851118 gbinv588.seq
1473724294 gbinv589.seq
544785313 gbinv59.seq
303768123 gbinv590.seq
1482098162 gbinv591.seq
1493449401 gbinv592.seq
186693625 gbinv593.seq
1474232828 gbinv594.seq
1456821165 gbinv595.seq
1288636561 gbinv596.seq
266841777 gbinv597.seq
1454813168 gbinv598.seq
598400576 gbinv599.seq
376886079 gbinv6.seq
1498785008 gbinv60.seq
1466601574 gbinv600.seq
442907988 gbinv601.seq
1456573641 gbinv602.seq
450458935 gbinv603.seq
1382342143 gbinv604.seq
1311359408 gbinv605.seq
1469464974 gbinv606.seq
1410573714 gbinv607.seq
172769725 gbinv608.seq
1475074278 gbinv609.seq
603657088 gbinv61.seq
1047572275 gbinv610.seq
1493941367 gbinv611.seq
1320519774 gbinv612.seq
1360414353 gbinv613.seq
549289075 gbinv614.seq
1433764026 gbinv615.seq
763646403 gbinv616.seq
1485107474 gbinv617.seq
383346236 gbinv618.seq
1496398328 gbinv619.seq
1479614288 gbinv62.seq
1405593335 gbinv620.seq
282285546 gbinv621.seq
1488486307 gbinv622.seq
139774590 gbinv623.seq
1486138248 gbinv624.seq
1495956862 gbinv625.seq
200580819 gbinv626.seq
1364141678 gbinv627.seq
1445853769 gbinv628.seq
464187387 gbinv629.seq
622090538 gbinv63.seq
1456011602 gbinv630.seq
1492021897 gbinv631.seq
1455513038 gbinv632.seq
607420336 gbinv633.seq
1457809849 gbinv634.seq
391487819 gbinv635.seq
1493536102 gbinv636.seq
405891713 gbinv637.seq
1494386441 gbinv638.seq
898135207 gbinv639.seq
1493842327 gbinv64.seq
1498797785 gbinv640.seq
420062004 gbinv641.seq
1487421789 gbinv642.seq
1359918423 gbinv643.seq
1446355632 gbinv644.seq
416385113 gbinv645.seq
1487964141 gbinv646.seq
622377949 gbinv647.seq
1330488898 gbinv648.seq
781012844 gbinv649.seq
1416177336 gbinv65.seq
1494742476 gbinv650.seq
359613667 gbinv651.seq
1495531651 gbinv652.seq
730071997 gbinv653.seq
882426802 gbinv654.seq
1391549013 gbinv655.seq
348223370 gbinv656.seq
1480519637 gbinv657.seq
1019143842 gbinv658.seq
1471388777 gbinv659.seq
119585423 gbinv66.seq
991065078 gbinv660.seq
1496789782 gbinv661.seq
916577370 gbinv662.seq
1328094736 gbinv663.seq
1293174012 gbinv664.seq
1487955820 gbinv665.seq
1058914911 gbinv666.seq
1315022365 gbinv667.seq
1495303361 gbinv668.seq
579569335 gbinv669.seq
1491972535 gbinv67.seq
1339680698 gbinv670.seq
1033801010 gbinv671.seq
1444565030 gbinv672.seq
506481911 gbinv673.seq
1431143280 gbinv674.seq
1487474924 gbinv675.seq
188364630 gbinv676.seq
1485486972 gbinv677.seq
1490457877 gbinv678.seq
143748171 gbinv679.seq
1373948446 gbinv68.seq
1480393377 gbinv680.seq
1455854789 gbinv681.seq
1430191058 gbinv682.seq
1491332213 gbinv683.seq
561720368 gbinv684.seq
1414146754 gbinv685.seq
1468601310 gbinv686.seq
1496553038 gbinv687.seq
896187392 gbinv688.seq
1455214357 gbinv689.seq
1475289316 gbinv69.seq
438664195 gbinv690.seq
1399948877 gbinv691.seq
664645337 gbinv692.seq
1479610876 gbinv693.seq
829840857 gbinv694.seq
1449261388 gbinv695.seq
641464470 gbinv696.seq
1478015439 gbinv697.seq
626080102 gbinv698.seq
1477053842 gbinv699.seq
1499044151 gbinv7.seq
813062851 gbinv70.seq
690971066 gbinv700.seq
1495345098 gbinv701.seq
533918523 gbinv702.seq
1363404622 gbinv703.seq
667544827 gbinv704.seq
1285411718 gbinv705.seq
442095444 gbinv706.seq
1439898744 gbinv707.seq
1235239831 gbinv708.seq
1456319177 gbinv709.seq
1484969356 gbinv71.seq
1193234454 gbinv710.seq
1313629197 gbinv711.seq
247425525 gbinv712.seq
1499807967 gbinv713.seq
404075944 gbinv714.seq
1490770554 gbinv715.seq
250762610 gbinv716.seq
1477609082 gbinv717.seq
547072028 gbinv718.seq
1461590078 gbinv719.seq
962155388 gbinv72.seq
759983319 gbinv720.seq
1435908609 gbinv721.seq
1484827153 gbinv722.seq
363604107 gbinv723.seq
1492209083 gbinv724.seq
367366059 gbinv725.seq
1499784421 gbinv726.seq
1104373125 gbinv727.seq
1493069824 gbinv728.seq
1215456811 gbinv729.seq
1491078346 gbinv73.seq
1486397133 gbinv730.seq
1246006985 gbinv731.seq
1247632781 gbinv732.seq
1469774909 gbinv733.seq
1226701605 gbinv734.seq
1306210890 gbinv735.seq
220144678 gbinv736.seq
1489544639 gbinv737.seq
1357913570 gbinv738.seq
1409850377 gbinv739.seq
928003060 gbinv74.seq
362223579 gbinv740.seq
1485497031 gbinv741.seq
491448177 gbinv742.seq
1492305994 gbinv743.seq
1204981677 gbinv744.seq
1498916960 gbinv745.seq
364756780 gbinv746.seq
1477226845 gbinv747.seq
422540971 gbinv748.seq
1466569383 gbinv749.seq
1498796751 gbinv75.seq
357530571 gbinv750.seq
1468997307 gbinv751.seq
1452486126 gbinv752.seq
1483476796 gbinv753.seq
1365877479 gbinv754.seq
178767394 gbinv755.seq
1489624021 gbinv756.seq
1487080559 gbinv757.seq
48852926 gbinv758.seq
1449894789 gbinv759.seq
867076088 gbinv76.seq
1395302798 gbinv760.seq
253522578 gbinv761.seq
1486157289 gbinv762.seq
696173833 gbinv763.seq
1458416908 gbinv764.seq
814939774 gbinv765.seq
1479062801 gbinv766.seq
738037935 gbinv767.seq
1217976463 gbinv768.seq
1046588527 gbinv769.seq
1495747298 gbinv77.seq
1422565381 gbinv770.seq
980137269 gbinv771.seq
1479037894 gbinv772.seq
1017570522 gbinv773.seq
1489307606 gbinv774.seq
980324643 gbinv775.seq
1483121377 gbinv776.seq
506324386 gbinv777.seq
1338271714 gbinv778.seq
670841568 gbinv779.seq
854906901 gbinv78.seq
1451740301 gbinv780.seq
488926617 gbinv781.seq
1460298086 gbinv782.seq
663465644 gbinv783.seq
1445208000 gbinv784.seq
699506754 gbinv785.seq
1479519514 gbinv786.seq
678461699 gbinv787.seq
1477356782 gbinv788.seq
774075524 gbinv789.seq
1488751864 gbinv79.seq
1498154189 gbinv790.seq
1033186830 gbinv791.seq
685164990 gbinv792.seq
1438661071 gbinv793.seq
1489193064 gbinv794.seq
450968981 gbinv795.seq
1488632788 gbinv796.seq
712610593 gbinv797.seq
1477656292 gbinv798.seq
785779795 gbinv799.seq
918521473 gbinv8.seq
819265355 gbinv80.seq
1425379516 gbinv800.seq
787269807 gbinv801.seq
1474254297 gbinv802.seq
1437961059 gbinv803.seq
256713283 gbinv804.seq
1484529176 gbinv805.seq
625639021 gbinv806.seq
1494007341 gbinv807.seq
862604065 gbinv808.seq
1469080509 gbinv809.seq
1492563121 gbinv81.seq
1221427361 gbinv810.seq
1447358318 gbinv811.seq
1267036515 gbinv812.seq
641221432 gbinv813.seq
1437902242 gbinv814.seq
882000540 gbinv815.seq
1149657667 gbinv816.seq
1212500670 gbinv817.seq
1061903042 gbinv818.seq
1279027406 gbinv819.seq
271764939 gbinv82.seq
1488412066 gbinv820.seq
946772983 gbinv821.seq
1469421448 gbinv822.seq
408517361 gbinv823.seq
1488068921 gbinv824.seq
1074331561 gbinv825.seq
1471446714 gbinv826.seq
1089245394 gbinv827.seq
1496624861 gbinv828.seq
363003470 gbinv829.seq
1499997521 gbinv83.seq
1486563514 gbinv830.seq
412890780 gbinv831.seq
1494065365 gbinv832.seq
418733099 gbinv833.seq
1475737261 gbinv834.seq
340704941 gbinv835.seq
1485085997 gbinv836.seq
1049160877 gbinv837.seq
1171084260 gbinv838.seq
339697667 gbinv839.seq
101558601 gbinv84.seq
1444118018 gbinv840.seq
591016312 gbinv841.seq
1496010311 gbinv842.seq
124374618 gbinv843.seq
1477313812 gbinv844.seq
1483445786 gbinv845.seq
91128417 gbinv846.seq
1338370292 gbinv847.seq
733987331 gbinv848.seq
1471879735 gbinv849.seq
1406801311 gbinv85.seq
1053677687 gbinv850.seq
671628694 gbinv851.seq
1388129956 gbinv852.seq
295588391 gbinv853.seq
1433770265 gbinv854.seq
476835269 gbinv855.seq
1433410472 gbinv856.seq
438228696 gbinv857.seq
1250726673 gbinv858.seq
611825037 gbinv859.seq
1182691682 gbinv86.seq
1493699074 gbinv860.seq
525660640 gbinv861.seq
1486073369 gbinv862.seq
322132118 gbinv863.seq
1402544732 gbinv864.seq
423016322 gbinv865.seq
1475530293 gbinv866.seq
1499027380 gbinv867.seq
1396587458 gbinv868.seq
1394302822 gbinv869.seq
1126254835 gbinv87.seq
528217521 gbinv870.seq
1466230627 gbinv871.seq
1343924683 gbinv872.seq
774782659 gbinv873.seq
1401591455 gbinv874.seq
1155865188 gbinv875.seq
837350261 gbinv876.seq
1441258603 gbinv877.seq
1462772577 gbinv878.seq
572595067 gbinv879.seq
1153108903 gbinv88.seq
1382009986 gbinv880.seq
608028412 gbinv881.seq
1380331263 gbinv882.seq
438520090 gbinv883.seq
1470077879 gbinv884.seq
783762965 gbinv885.seq
1176366200 gbinv886.seq
608322919 gbinv887.seq
1205408689 gbinv888.seq
1104142746 gbinv889.seq
1157055481 gbinv89.seq
1036632038 gbinv890.seq
923782898 gbinv891.seq
1217966648 gbinv892.seq
1082974717 gbinv893.seq
1128407176 gbinv894.seq
731766010 gbinv895.seq
1443670782 gbinv896.seq
922178852 gbinv897.seq
1347794179 gbinv898.seq
747649030 gbinv899.seq
1493247423 gbinv9.seq
1191512375 gbinv90.seq
1460306287 gbinv900.seq
900427213 gbinv901.seq
1477710109 gbinv902.seq
792551859 gbinv903.seq
1409054861 gbinv904.seq
896382991 gbinv905.seq
1269865578 gbinv906.seq
1301155539 gbinv907.seq
943349247 gbinv908.seq
878734428 gbinv909.seq
1247548757 gbinv91.seq
874599051 gbinv910.seq
872525010 gbinv911.seq
810605264 gbinv912.seq
791733648 gbinv913.seq
789407447 gbinv914.seq
782472280 gbinv915.seq
1478877159 gbinv916.seq
1425054466 gbinv917.seq
1232428257 gbinv918.seq
1159914346 gbinv919.seq
1499998250 gbinv92.seq
1489477121 gbinv920.seq
427244069 gbinv921.seq
1497897156 gbinv922.seq
548539976 gbinv923.seq
1436968217 gbinv924.seq
933768365 gbinv925.seq
1491275346 gbinv926.seq
869474520 gbinv927.seq
1450231548 gbinv928.seq
1342343925 gbinv929.seq
692686067 gbinv93.seq
1451776732 gbinv930.seq
540560242 gbinv931.seq
1476017219 gbinv932.seq
983921298 gbinv933.seq
1447912985 gbinv934.seq
1437245729 gbinv935.seq
1480916438 gbinv936.seq
561131412 gbinv937.seq
1477416158 gbinv938.seq
815721365 gbinv939.seq
955572480 gbinv94.seq
1489540966 gbinv940.seq
649631068 gbinv941.seq
1486418220 gbinv942.seq
1485766453 gbinv943.seq
299017541 gbinv944.seq
1447293450 gbinv945.seq
1424436854 gbinv946.seq
555359826 gbinv947.seq
1490369912 gbinv948.seq
1454124707 gbinv949.seq
289059083 gbinv95.seq
236657036 gbinv950.seq
1410657895 gbinv951.seq
1499881679 gbinv952.seq
352677392 gbinv953.seq
1494772634 gbinv954.seq
688582722 gbinv955.seq
1499431451 gbinv956.seq
805871519 gbinv957.seq
1453297195 gbinv958.seq
773837307 gbinv959.seq
54983086 gbinv96.seq
1335852192 gbinv960.seq
527825304 gbinv961.seq
1476565583 gbinv962.seq
680958925 gbinv963.seq
1463772379 gbinv964.seq
562324008 gbinv965.seq
1496442964 gbinv966.seq
559742644 gbinv967.seq
1479845810 gbinv968.seq
358265933 gbinv969.seq
52942590 gbinv97.seq
1445692355 gbinv970.seq
591239914 gbinv971.seq
1409906324 gbinv972.seq
564609714 gbinv973.seq
1375758712 gbinv974.seq
814258094 gbinv975.seq
1465790531 gbinv976.seq
710509361 gbinv977.seq
1332386478 gbinv978.seq
1007465375 gbinv979.seq
157078175 gbinv98.seq
1483491452 gbinv980.seq
1218171606 gbinv981.seq
1446948614 gbinv982.seq
1107260814 gbinv983.seq
1488515265 gbinv984.seq
1090427935 gbinv985.seq
1473901953 gbinv986.seq
1041928661 gbinv987.seq
1441427152 gbinv988.seq
1386697076 gbinv989.seq
768189501 gbinv99.seq
608783665 gbinv990.seq
1499618036 gbinv991.seq
297893234 gbinv992.seq
1476443088 gbinv993.seq
573065947 gbinv994.seq
1191529685 gbinv995.seq
1176457428 gbinv996.seq
1118724487 gbinv997.seq
1448943866 gbinv998.seq
374045261 gbinv999.seq
1299927431 gbmam1.seq
417714201 gbmam10.seq
345212224 gbmam100.seq
1483991848 gbmam101.seq
394044618 gbmam102.seq
1407365696 gbmam103.seq
225944987 gbmam104.seq
1441479786 gbmam105.seq
469953643 gbmam106.seq
1344156070 gbmam107.seq
375382417 gbmam108.seq
1405793837 gbmam109.seq
1454600951 gbmam11.seq
329856862 gbmam110.seq
1451013218 gbmam111.seq
268468305 gbmam112.seq
1414660892 gbmam113.seq
465828461 gbmam114.seq
1456302792 gbmam115.seq
544855284 gbmam116.seq
1316003895 gbmam117.seq
825457177 gbmam118.seq
1465506657 gbmam119.seq
1491732579 gbmam12.seq
834197260 gbmam120.seq
1442051766 gbmam121.seq
821884489 gbmam122.seq
1453876757 gbmam123.seq
1208505762 gbmam124.seq
1376302879 gbmam125.seq
1359500385 gbmam126.seq
238286100 gbmam127.seq
1395204913 gbmam128.seq
1360844519 gbmam129.seq
132948661 gbmam13.seq
1426041019 gbmam130.seq
981344570 gbmam131.seq
1452412349 gbmam132.seq
1422874419 gbmam133.seq
408481718 gbmam134.seq
1493203952 gbmam135.seq
306899300 gbmam136.seq
1348485231 gbmam137.seq
529814629 gbmam138.seq
1479589965 gbmam139.seq
1443615542 gbmam14.seq
1003077955 gbmam140.seq
1442404367 gbmam141.seq
834292099 gbmam142.seq
1482830580 gbmam143.seq
1108515895 gbmam144.seq
1356418005 gbmam145.seq
1450451476 gbmam146.seq
198338337 gbmam147.seq
1472637635 gbmam148.seq
1481463696 gbmam149.seq
531711770 gbmam15.seq
142270519 gbmam150.seq
1405794202 gbmam151.seq
1483682369 gbmam152.seq
277715394 gbmam153.seq
1432986514 gbmam154.seq
919898592 gbmam155.seq
1355826661 gbmam156.seq
1012666587 gbmam157.seq
1492187184 gbmam158.seq
927075547 gbmam159.seq
1417477477 gbmam16.seq
1474648453 gbmam160.seq
442335081 gbmam161.seq
1494089828 gbmam162.seq
503907043 gbmam163.seq
1318911633 gbmam164.seq
610345039 gbmam165.seq
1338335661 gbmam166.seq
731448449 gbmam167.seq
1387100376 gbmam168.seq
546744117 gbmam169.seq
560290656 gbmam17.seq
1323531595 gbmam170.seq
713159138 gbmam171.seq
1443857071 gbmam172.seq
570952798 gbmam173.seq
1265661494 gbmam174.seq
845102809 gbmam175.seq
1479725176 gbmam176.seq
768765653 gbmam177.seq
1499323699 gbmam178.seq
993450991 gbmam179.seq
1491564169 gbmam18.seq
1492397698 gbmam180.seq
933948278 gbmam181.seq
1395293696 gbmam182.seq
1365984070 gbmam183.seq
400375561 gbmam184.seq
1367302097 gbmam185.seq
1387935804 gbmam186.seq
644513637 gbmam187.seq
1421584696 gbmam188.seq
1491183425 gbmam189.seq
313468224 gbmam19.seq
314903969 gbmam190.seq
1439033231 gbmam191.seq
1493156941 gbmam192.seq
392375520 gbmam193.seq
477148353 gbmam2.seq
1499406394 gbmam20.seq
1062035477 gbmam21.seq
1485199324 gbmam22.seq
1304037360 gbmam23.seq
1433300115 gbmam24.seq
1485894617 gbmam25.seq
80282300 gbmam26.seq
1429685510 gbmam27.seq
1469067667 gbmam28.seq
196370196 gbmam29.seq
1469194323 gbmam3.seq
1469882755 gbmam30.seq
1491807629 gbmam31.seq
126770122 gbmam32.seq
1445042334 gbmam33.seq
1365011074 gbmam34.seq
312272841 gbmam35.seq
1443977589 gbmam36.seq
1443579369 gbmam37.seq
160637457 gbmam38.seq
1486996016 gbmam39.seq
505262173 gbmam4.seq
1411071027 gbmam40.seq
159870984 gbmam41.seq
1391311962 gbmam42.seq
1321432348 gbmam43.seq
395788799 gbmam44.seq
1464519465 gbmam45.seq
1441977794 gbmam46.seq
252080586 gbmam47.seq
9943311 gbmam48.seq
43988539 gbmam49.seq
82874332 gbmam5.seq
91321391 gbmam50.seq
88810864 gbmam51.seq
6370323 gbmam52.seq
21019042 gbmam53.seq
449718250 gbmam54.seq
1459776468 gbmam55.seq
1181085315 gbmam56.seq
1499998622 gbmam57.seq
926197102 gbmam58.seq
839494897 gbmam59.seq
71378354 gbmam6.seq
774395849 gbmam60.seq
1382131671 gbmam61.seq
1055303580 gbmam62.seq
1486708589 gbmam63.seq
801027489 gbmam64.seq
1455155074 gbmam65.seq
830552812 gbmam66.seq
1430736847 gbmam67.seq
988623543 gbmam68.seq
1463225335 gbmam69.seq
22591545 gbmam7.seq
1040235833 gbmam70.seq
1494407093 gbmam71.seq
1381042541 gbmam72.seq
1383327549 gbmam73.seq
1473290653 gbmam74.seq
427109812 gbmam75.seq
1378869423 gbmam76.seq
1482299281 gbmam77.seq
326072158 gbmam78.seq
1427810688 gbmam79.seq
1269223 gbmam8.seq
1423540895 gbmam80.seq
408291238 gbmam81.seq
1416530939 gbmam82.seq
1476987068 gbmam83.seq
508139671 gbmam84.seq
1363509798 gbmam85.seq
287465635 gbmam86.seq
1433940798 gbmam87.seq
390298825 gbmam88.seq
1374324242 gbmam89.seq
1344982518 gbmam9.seq
733536654 gbmam90.seq
1468553408 gbmam91.seq
405323312 gbmam92.seq
1426269234 gbmam93.seq
733331809 gbmam94.seq
1407233551 gbmam95.seq
980079942 gbmam96.seq
1443508442 gbmam97.seq
780606100 gbmam98.seq
1424198150 gbmam99.seq
14567467 gbnew.txt
1061258129 gbpat1.seq
666883320 gbpat10.seq
1499998960 gbpat100.seq
187733203 gbpat101.seq
1481546501 gbpat102.seq
1385155853 gbpat103.seq
1435129832 gbpat104.seq
1107869813 gbpat105.seq
1163545267 gbpat106.seq
1499392915 gbpat107.seq
786172197 gbpat108.seq
1499993700 gbpat109.seq
1213212812 gbpat11.seq
784117079 gbpat110.seq
906229410 gbpat12.seq
1126663144 gbpat13.seq
1500000226 gbpat14.seq
140158506 gbpat15.seq
1499514937 gbpat16.seq
638473657 gbpat17.seq
1499999269 gbpat18.seq
87886088 gbpat19.seq
1419250906 gbpat2.seq
1499998958 gbpat20.seq
130975844 gbpat21.seq
1185014004 gbpat22.seq
1137264062 gbpat23.seq
1429497634 gbpat24.seq
821477819 gbpat25.seq
1306530784 gbpat26.seq
1144915269 gbpat27.seq
726234433 gbpat28.seq
1309498169 gbpat29.seq
1317354869 gbpat3.seq
1259593484 gbpat30.seq
1036781105 gbpat31.seq
974766108 gbpat32.seq
831709767 gbpat33.seq
812778995 gbpat34.seq
1499999454 gbpat35.seq
206004823 gbpat36.seq
955869012 gbpat37.seq
752680559 gbpat38.seq
1083037238 gbpat39.seq
1179047474 gbpat4.seq
998235851 gbpat40.seq
1499998334 gbpat41.seq
228716814 gbpat42.seq
1499999586 gbpat43.seq
335513014 gbpat44.seq
1210707279 gbpat45.seq
1174069033 gbpat46.seq
1499996170 gbpat47.seq
8881342 gbpat48.seq
882584489 gbpat49.seq
1062754919 gbpat5.seq
1499991426 gbpat50.seq
556649409 gbpat51.seq
1208428662 gbpat52.seq
1059361413 gbpat53.seq
1488853601 gbpat54.seq
1028330843 gbpat55.seq
885160936 gbpat56.seq
1148513038 gbpat57.seq
814549904 gbpat58.seq
1409506237 gbpat59.seq
1422341815 gbpat6.seq
1125979819 gbpat60.seq
1499995379 gbpat61.seq
669882745 gbpat62.seq
926363093 gbpat63.seq
1499970773 gbpat64.seq
353672172 gbpat65.seq
1291261617 gbpat66.seq
1499999951 gbpat67.seq
102925323 gbpat68.seq
1499997024 gbpat69.seq
1499996116 gbpat7.seq
801705817 gbpat70.seq
1499999326 gbpat71.seq
319831352 gbpat72.seq
1499998956 gbpat73.seq
13003496 gbpat74.seq
1499998700 gbpat75.seq
84107819 gbpat76.seq
1499999698 gbpat77.seq
39679778 gbpat78.seq
1499998783 gbpat79.seq
347885988 gbpat8.seq
595880376 gbpat80.seq
1499998074 gbpat81.seq
590176661 gbpat82.seq
1500000231 gbpat83.seq
504082894 gbpat84.seq
1499998928 gbpat85.seq
478202128 gbpat86.seq
1321704167 gbpat87.seq
1350590572 gbpat88.seq
1418827872 gbpat89.seq
1499560750 gbpat9.seq
1335688240 gbpat90.seq
1499999888 gbpat91.seq
361476181 gbpat92.seq
1336382704 gbpat93.seq
1366896121 gbpat94.seq
1388591258 gbpat95.seq
1498667620 gbpat96.seq
1021954298 gbpat97.seq
1499998858 gbpat98.seq
988153697 gbpat99.seq
1499988889 gbphg1.seq
1499918521 gbphg2.seq
451070059 gbphg3.seq
1499967469 gbpln1.seq
1065209035 gbpln10.seq
1492751092 gbpln100.seq
794050155 gbpln1000.se
769006557 gbpln1001.se
1456537015 gbpln1002.se
1456423619 gbpln1003.se
831709070 gbpln1004.se
788018842 gbpln1005.se
776335169 gbpln1006.se
1447227790 gbpln1007.se
1462058950 gbpln1008.se
831948388 gbpln1009.se
277490571 gbpln101.seq
792155198 gbpln1010.se
764395262 gbpln1011.se
1469026353 gbpln1012.se
1457035185 gbpln1013.se
832913531 gbpln1014.se
783381753 gbpln1015.se
777226068 gbpln1016.se
1449010173 gbpln1017.se
800066153 gbpln1018.se
659967910 gbpln1019.se
1490746088 gbpln102.seq
856583956 gbpln1020.se
800941652 gbpln1021.se
764839742 gbpln1022.se
1463437687 gbpln1023.se
1457211428 gbpln1024.se
838548263 gbpln1025.se
802434969 gbpln1026.se
775426580 gbpln1027.se
752476251 gbpln1028.se
715776003 gbpln1029.se
928539912 gbpln103.seq
1456996280 gbpln1030.se
836584181 gbpln1031.se
794556424 gbpln1032.se
763379903 gbpln1033.se
1472540376 gbpln1034.se
1467456049 gbpln1035.se
841588738 gbpln1036.se
793586134 gbpln1037.se
774193867 gbpln1038.se
1483592341 gbpln1039.se
1473119297 gbpln104.seq
810458180 gbpln1040.se
1487039739 gbpln1041.se
787519848 gbpln1042.se
773580779 gbpln1043.se
746701676 gbpln1044.se
707267128 gbpln1045.se
1458876982 gbpln1046.se
836647346 gbpln1047.se
804025439 gbpln1048.se
780287538 gbpln1049.se
838249670 gbpln105.seq
1456910352 gbpln1050.se
1461116472 gbpln1051.se
847868246 gbpln1052.se
799503372 gbpln1053.se
769858206 gbpln1054.se
1451384311 gbpln1055.se
1448178189 gbpln1056.se
841182041 gbpln1057.se
790643458 gbpln1058.se
771991396 gbpln1059.se
1492027099 gbpln106.seq
1449905951 gbpln1060.se
799948094 gbpln1061.se
836052023 gbpln1062.se
791807903 gbpln1063.se
771195581 gbpln1064.se
1452626437 gbpln1065.se
1452862185 gbpln1066.se
666670554 gbpln1067.se
841954477 gbpln1068.se
801058908 gbpln1069.se
456902623 gbpln107.seq
777293273 gbpln1070.se
1485779606 gbpln1071.se
1452913123 gbpln1072.se
836617455 gbpln1073.se
790837080 gbpln1074.se
777459211 gbpln1075.se
747254822 gbpln1076.se
706272554 gbpln1077.se
1454781570 gbpln1078.se
839842771 gbpln1079.se
1470929552 gbpln108.seq
793797446 gbpln1080.se
776363695 gbpln1081.se
1456772382 gbpln1082.se
1466569984 gbpln1083.se
845148876 gbpln1084.se
804833075 gbpln1085.se
778470840 gbpln1086.se
1481006671 gbpln1087.se
1474068833 gbpln1088.se
794180240 gbpln1089.se
1072538928 gbpln109.seq
774312133 gbpln1090.se
1457303715 gbpln1091.se
835115958 gbpln1092.se
1457626965 gbpln1093.se
836718376 gbpln1094.se
801816184 gbpln1095.se
780710757 gbpln1096.se
754364739 gbpln1097.se
733491153 gbpln1098.se
1468374098 gbpln1099.se
1329547562 gbpln11.seq
1442027945 gbpln110.seq
835020955 gbpln1100.se
794498288 gbpln1101.se
775035874 gbpln1102.se
1474921682 gbpln1103.se
1459702205 gbpln1104.se
836763144 gbpln1105.se
794319485 gbpln1106.se
771563218 gbpln1107.se
1442336042 gbpln1108.se
796083444 gbpln1109.se
374599517 gbpln111.seq
665841375 gbpln1110.se
835744193 gbpln1111.se
793808494 gbpln1112.se
775366859 gbpln1113.se
744449290 gbpln1114.se
708201546 gbpln1115.se
1461461120 gbpln1116.se
839340148 gbpln1117.se
793588555 gbpln1118.se
778845059 gbpln1119.se
1423355024 gbpln112.seq
1471514124 gbpln1120.se
1460672453 gbpln1121.se
847689175 gbpln1122.se
797030463 gbpln1123.se
776617524 gbpln1124.se
1450233858 gbpln1125.se
1469651463 gbpln1126.se
834034797 gbpln1127.se
795540701 gbpln1128.se
776376885 gbpln1129.se
474188431 gbpln113.seq
1448905128 gbpln1130.se
1457656304 gbpln1131.se
833009352 gbpln1132.se
797524540 gbpln1133.se
773297930 gbpln1134.se
1451244889 gbpln1135.se
1454193216 gbpln1136.se
830169429 gbpln1137.se
793310457 gbpln1138.se
773560290 gbpln1139.se
1446165182 gbpln114.seq
1446231891 gbpln1140.se
1450937303 gbpln1141.se
835938341 gbpln1142.se
795056321 gbpln1143.se
770765157 gbpln1144.se
1475561524 gbpln1145.se
1466579245 gbpln1146.se
829099164 gbpln1147.se
790989379 gbpln1148.se
773398673 gbpln1149.se
434452448 gbpln115.seq
1462046272 gbpln1150.se
1449910042 gbpln1151.se
837413052 gbpln1152.se
790648527 gbpln1153.se
772176401 gbpln1154.se
1460620041 gbpln1155.se
1455765886 gbpln1156.se
833059054 gbpln1157.se
794545184 gbpln1158.se
774083177 gbpln1159.se
1450295359 gbpln116.seq
1448946753 gbpln1160.se
1458559584 gbpln1161.se
835451342 gbpln1162.se
794577233 gbpln1163.se
775251446 gbpln1164.se
1454531761 gbpln1165.se
1463618989 gbpln1166.se
836809812 gbpln1167.se
806584862 gbpln1168.se
776084155 gbpln1169.se
437301293 gbpln117.seq
1485075661 gbpln1170.se
1448852265 gbpln1171.se
836125457 gbpln1172.se
794049612 gbpln1173.se
769729355 gbpln1174.se
742587081 gbpln1175.se
727014800 gbpln1176.se
1458361301 gbpln1177.se
840008504 gbpln1178.se
794029694 gbpln1179.se
1438505364 gbpln118.seq
769623341 gbpln1180.se
1477482614 gbpln1181.se
1456549528 gbpln1182.se
836931236 gbpln1183.se
792455888 gbpln1184.se
768695354 gbpln1185.se
749845408 gbpln1186.se
1496378667 gbpln1187.se
659612022 gbpln1188.se
835570197 gbpln1189.se
431801697 gbpln119.seq
798619346 gbpln1190.se
776375847 gbpln1191.se
751020200 gbpln1192.se
717192214 gbpln1193.se
803740372 gbpln1194.se
1492235450 gbpln1195.se
793920035 gbpln1196.se
773324985 gbpln1197.se
1443647684 gbpln1198.se
793436257 gbpln1199.se
339200186 gbpln12.seq
1446968734 gbpln120.seq
665530976 gbpln1200.se
834886228 gbpln1201.se
792465315 gbpln1202.se
766375549 gbpln1203.se
1449349195 gbpln1204.se
1457671779 gbpln1205.se
836173230 gbpln1206.se
792990723 gbpln1207.se
774691916 gbpln1208.se
1452432506 gbpln1209.se
454547997 gbpln121.seq
797342703 gbpln1210.se
1496638015 gbpln1211.se
804070482 gbpln1212.se
777569920 gbpln1213.se
1461158646 gbpln1214.se
1466754128 gbpln1215.se
830451601 gbpln1216.se
798616435 gbpln1217.se
774880678 gbpln1218.se
1455218535 gbpln1219.se
1468596447 gbpln122.seq
1460523331 gbpln1220.se
837230145 gbpln1221.se
796560308 gbpln1222.se
777015504 gbpln1223.se
751686997 gbpln1224.se
703906948 gbpln1225.se
1455711383 gbpln1226.se
838785071 gbpln1227.se
791233293 gbpln1228.se
770014685 gbpln1229.se
368962914 gbpln123.seq
1450013191 gbpln1230.se
795356170 gbpln1231.se
1495631000 gbpln1232.se
793372574 gbpln1233.se
769401747 gbpln1234.se
1456544663 gbpln1235.se
1465313453 gbpln1236.se
839230685 gbpln1237.se
803963907 gbpln1238.se
778586682 gbpln1239.se
1387452925 gbpln124.seq
1463130395 gbpln1240.se
1457728697 gbpln1241.se
832496071 gbpln1242.se
797513192 gbpln1243.se
776551156 gbpln1244.se
1449845840 gbpln1245.se
1460493739 gbpln1246.se
839860091 gbpln1247.se
789840368 gbpln1248.se
776969912 gbpln1249.se
626279429 gbpln125.seq
1450486337 gbpln1250.se
1014429015 gbpln1251.se
1476253038 gbpln1252.se
1108449375 gbpln1253.se
1352500221 gbpln1254.se
1271576965 gbpln1255.se
575997766 gbpln1256.se
1111693114 gbpln1257.se
480735429 gbpln1258.se
1499799432 gbpln1259.se
818536598 gbpln126.seq
287261970 gbpln1260.se
903265270 gbpln1261.se
659287868 gbpln1262.se
830295693 gbpln1263.se
794035728 gbpln1264.se
766241777 gbpln1265.se
750933536 gbpln1266.se
701025885 gbpln1267.se
1460262157 gbpln1268.se
800420442 gbpln1269.se
744339771 gbpln127.seq
807100878 gbpln1270.se
813165275 gbpln1271.se
1489858794 gbpln1272.se
1463645427 gbpln1273.se
836403024 gbpln1274.se
797704105 gbpln1275.se
771673145 gbpln1276.se
1489073756 gbpln1277.se
803038467 gbpln1278.se
1494983263 gbpln1279.se
840483636 gbpln128.seq
794511021 gbpln1280.se
765022116 gbpln1281.se
1450430027 gbpln1282.se
1446394679 gbpln1283.se
837987830 gbpln1284.se
795104781 gbpln1285.se
772053911 gbpln1286.se
744822794 gbpln1287.se
709518859 gbpln1288.se
1471789737 gbpln1289.se
1482268558 gbpln129.seq
159962507 gbpln1290.se
1451442059 gbpln1291.se
474894144 gbpln1292.se
820639220 gbpln1293.se
834487583 gbpln1294.se
1438167305 gbpln1295.se
942730875 gbpln1296.se
1413074394 gbpln1297.se
1271934713 gbpln1298.se
1485567802 gbpln1299.se
1220877249 gbpln13.seq
1445216054 gbpln130.seq
1184860474 gbpln1300.se
756169196 gbpln1301.se
1245067321 gbpln1302.se
1442415305 gbpln1303.se
498525119 gbpln1304.se
1480509074 gbpln1305.se
251935681 gbpln1306.se
1489873164 gbpln1307.se
669405908 gbpln1308.se
1003550591 gbpln1309.se
372631992 gbpln131.seq
818534977 gbpln1310.se
744338029 gbpln1311.se
840481828 gbpln1312.se
1482265733 gbpln1313.se
867339882 gbpln1314.se
665178568 gbpln1315.se
840478319 gbpln1316.se
804862544 gbpln1317.se
775136193 gbpln1318.se
1456887584 gbpln1319.se
1467625507 gbpln132.seq
1470716689 gbpln1320.se
836948259 gbpln1321.se
794972859 gbpln1322.se
775455598 gbpln1323.se
1463119445 gbpln1324.se
794996206 gbpln1325.se
656305255 gbpln1326.se
852997313 gbpln1327.se
798187575 gbpln1328.se
776406263 gbpln1329.se
401299113 gbpln133.seq
1458385249 gbpln1330.se
1463826120 gbpln1331.se
833048862 gbpln1332.se
794071582 gbpln1333.se
772684697 gbpln1334.se
1454827832 gbpln1335.se
793225130 gbpln1336.se
1497588685 gbpln1337.se
798464996 gbpln1338.se
775710033 gbpln1339.se
1462820325 gbpln134.seq
744924658 gbpln1340.se
719062576 gbpln1341.se
1455516963 gbpln1342.se
827472017 gbpln1343.se
799696373 gbpln1344.se
771541363 gbpln1345.se
1456098533 gbpln1346.se
1450468258 gbpln1347.se
830011447 gbpln1348.se
803324869 gbpln1349.se
1144623389 gbpln135.seq
778613518 gbpln1350.se
757477427 gbpln1351.se
728058413 gbpln1352.se
1460285834 gbpln1353.se
834396522 gbpln1354.se
793156442 gbpln1355.se
771664945 gbpln1356.se
1460976066 gbpln1357.se
1472747650 gbpln1358.se
831402033 gbpln1359.se
1461834256 gbpln136.seq
788227480 gbpln1360.se
773608315 gbpln1361.se
756195357 gbpln1362.se
703056123 gbpln1363.se
1457115869 gbpln1364.se
833114761 gbpln1365.se
791988363 gbpln1366.se
773778680 gbpln1367.se
1439338108 gbpln1368.se
798246923 gbpln1369.se
1282208769 gbpln137.seq
1494014271 gbpln1370.se
790630518 gbpln1371.se
774554078 gbpln1372.se
1459431387 gbpln1373.se
1462622889 gbpln1374.se
841885928 gbpln1375.se
814740283 gbpln1376.se
781686950 gbpln1377.se
1470777020 gbpln1378.se
817350531 gbpln1379.se
1487472399 gbpln138.seq
1493108072 gbpln1380.se
803943397 gbpln1381.se
776352617 gbpln1382.se
1461742228 gbpln1383.se
1468260082 gbpln1384.se
833628952 gbpln1385.se
800337028 gbpln1386.se
775679569 gbpln1387.se
1485372410 gbpln1388.se
1470684487 gbpln1389.se
1238608963 gbpln139.seq
837791026 gbpln1390.se
805450455 gbpln1391.se
782697461 gbpln1392.se
1462403294 gbpln1393.se
810098655 gbpln1394.se
661446766 gbpln1395.se
844251896 gbpln1396.se
800661389 gbpln1397.se
770104661 gbpln1398.se
1486820730 gbpln1399.se
492842184 gbpln14.seq
1498823682 gbpln140.seq
1437673274 gbpln1400.se
1239300617 gbpln1401.se
1472688110 gbpln1402.se
542516421 gbpln1403.se
1497781051 gbpln1404.se
1000301686 gbpln1405.se
1474391497 gbpln1406.se
880465505 gbpln1407.se
1479642284 gbpln1408.se
390210590 gbpln1409.se
450493017 gbpln141.seq
1475783456 gbpln1410.se
386638564 gbpln1411.se
1494082682 gbpln1412.se
920369574 gbpln1413.se
1451245782 gbpln1414.se
432601888 gbpln1415.se
1496254118 gbpln1416.se
1375887719 gbpln1417.se
1252557046 gbpln1418.se
1083691486 gbpln1419.se
1415728346 gbpln142.seq
1421898882 gbpln1420.se
731360424 gbpln1421.se
2734223096 gbpln1422.se
2727931901 gbpln1423.se
2720692598 gbpln1424.se
2732441076 gbpln1425.se
2733260927 gbpln1426.se
157556535 gbpln1427.se
2694271430 gbpln1428.se
2735442486 gbpln1429.se
488652574 gbpln143.seq
2720859722 gbpln1430.se
2732011308 gbpln1431.se
2383529845 gbpln1432.se
2723191931 gbpln1433.se
2689474086 gbpln1434.se
2737751830 gbpln1435.se
2700210160 gbpln1436.se
2006289519 gbpln1437.se
2636141786 gbpln1438.se
2722875815 gbpln1439.se
1121159029 gbpln144.seq
2725415454 gbpln1440.se
2730393002 gbpln1441.se
1948886785 gbpln1442.se
2738131093 gbpln1443.se
2727379378 gbpln1444.se
2679871098 gbpln1445.se
2737685310 gbpln1446.se
786720890 gbpln1447.se
2727907345 gbpln1448.se
2657432129 gbpln1449.se
565589051 gbpln145.seq
2735229991 gbpln1450.se
2728645371 gbpln1451.se
218791011 gbpln1452.se
2719617838 gbpln1453.se
2721885171 gbpln1454.se
2721092581 gbpln1455.se
2679558604 gbpln1456.se
181580803 gbpln1457.se
2722179116 gbpln1458.se
2736369220 gbpln1459.se
1249639254 gbpln146.seq
2726783046 gbpln1460.se
2440060122 gbpln1461.se
2736724965 gbpln1462.se
2696541624 gbpln1463.se
422496617 gbpln1464.se
2731302183 gbpln1465.se
2702984894 gbpln1466.se
2732485324 gbpln1467.se
1906858977 gbpln1468.se
1333776538 gbpln1469.se
920959563 gbpln147.seq
366349995 gbpln1470.se
1478630796 gbpln1471.se
1339182106 gbpln1472.se
1431604314 gbpln1473.se
1278608219 gbpln1474.se
1257873412 gbpln1475.se
1295731353 gbpln1476.se
718233528 gbpln1477.se
1291263007 gbpln1478.se
1286241557 gbpln1479.se
1225587576 gbpln148.seq
1294607816 gbpln1480.se
682550439 gbpln1481.se
1244306965 gbpln1482.se
1229287067 gbpln1483.se
1239215741 gbpln1484.se
658635449 gbpln1485.se
1227045645 gbpln1486.se
1241387178 gbpln1487.se
568398582 gbpln1488.se
1451146676 gbpln1489.se
946518369 gbpln149.seq
608730243 gbpln1490.se
1194598426 gbpln1491.se
1267961203 gbpln1492.se
1465598311 gbpln1493.se
605904859 gbpln1494.se
1211807832 gbpln1495.se
1270318273 gbpln1496.se
1429873158 gbpln1497.se
642562848 gbpln1498.se
1201259963 gbpln1499.se
1408071661 gbpln15.seq
1120694900 gbpln150.seq
1114385426 gbpln1500.se
1428292861 gbpln1501.se
617624847 gbpln1502.se
1189205804 gbpln1503.se
1121198560 gbpln1504.se
691947282 gbpln1505.se
1193254570 gbpln1506.se
623008870 gbpln1507.se
1169793616 gbpln1508.se
1196787416 gbpln1509.se
1163541839 gbpln151.seq
1107335684 gbpln1510.se
1110445392 gbpln1511.se
1215984046 gbpln1512.se
1274875612 gbpln1513.se
1168979121 gbpln1514.se
533030891 gbpln1515.se
1179251584 gbpln1516.se
1319824235 gbpln1517.se
1194499724 gbpln1518.se
1150884296 gbpln1519.se
650965042 gbpln152.seq
1260272463 gbpln1520.se
1277796253 gbpln1521.se
1077009674 gbpln1522.se
596414735 gbpln1523.se
1259716685 gbpln1524.se
1082028871 gbpln1525.se
1156068258 gbpln1526.se
1092988656 gbpln1527.se
1294048234 gbpln1528.se
1076722872 gbpln1529.se
1492041796 gbpln153.seq
465690537 gbpln1530.se
1155398206 gbpln1531.se
700947969 gbpln1532.se
1224815553 gbpln1533.se
1109978919 gbpln1534.se
549436340 gbpln1535.se
1263097017 gbpln1536.se
665776881 gbpln1537.se
1235574924 gbpln1538.se
1264341710 gbpln1539.se
791315393 gbpln154.seq
673868938 gbpln1540.se
1263623363 gbpln1541.se
633286407 gbpln1542.se
1197205337 gbpln1543.se
1237679873 gbpln1544.se
1312659113 gbpln1545.se
604892488 gbpln1546.se
1400966271 gbpln1547.se
1382372150 gbpln1548.se
1176735774 gbpln1549.se
1397400845 gbpln155.seq
693282470 gbpln1550.se
1202343442 gbpln1551.se
1264869868 gbpln1552.se
1017777200 gbpln1553.se
1203792449 gbpln1554.se
1383213588 gbpln1555.se
1260660216 gbpln1556.se
1233634175 gbpln1557.se
563260621 gbpln1558.se
1296551517 gbpln1559.se
908838186 gbpln156.seq
1158563945 gbpln1560.se
1059918971 gbpln1561.se
548217914 gbpln1562.se
1341167222 gbpln1563.se
1178297011 gbpln1564.se
504851755 gbpln1565.se
1193454949 gbpln1566.se
618979127 gbpln1567.se
1165155999 gbpln1568.se
1145365869 gbpln1569.se
1427470803 gbpln157.seq
594649456 gbpln1570.se
1136283639 gbpln1571.se
675038822 gbpln1572.se
1200907806 gbpln1573.se
1185642826 gbpln1574.se
552386546 gbpln1575.se
1388485833 gbpln1576.se
600740349 gbpln1577.se
1103058291 gbpln1578.se
1122948167 gbpln1579.se
1155687559 gbpln158.seq
1380211962 gbpln1580.se
519573430 gbpln1581.se
1132007157 gbpln1582.se
718467381 gbpln1583.se
1458132990 gbpln1584.se
554911284 gbpln1585.se
1461363702 gbpln1586.se
457185667 gbpln1587.se
1473493878 gbpln1588.se
565738080 gbpln1589.se
1457505595 gbpln159.seq
1418156015 gbpln1590.se
460270631 gbpln1591.se
1442039536 gbpln1592.se
554133236 gbpln1593.se
1463090663 gbpln1594.se
567868705 gbpln1595.se
1192724444 gbpln1596.se
814010732 gbpln1597.se
1048521841 gbpln1598.se
1038155649 gbpln1599.se
966026385 gbpln16.seq
672317516 gbpln160.seq
833369914 gbpln1600.se
931292853 gbpln1601.se
811379776 gbpln1602.se
1077992421 gbpln1603.se
812614241 gbpln1604.se
1052276437 gbpln1605.se
1035793500 gbpln1606.se
832863065 gbpln1607.se
922247149 gbpln1608.se
807661511 gbpln1609.se
1473831455 gbpln161.seq
1066166792 gbpln1610.se
997697986 gbpln1611.se
693641164 gbpln1612.se
1177445344 gbpln1613.se
1163060695 gbpln1614.se
1021882786 gbpln1615.se
1191242602 gbpln1616.se
609801478 gbpln1617.se
1205643923 gbpln1618.se
554031927 gbpln1619.se
390992687 gbpln162.seq
1342568934 gbpln1620.se
1163523207 gbpln1621.se
500443859 gbpln1622.se
1226448377 gbpln1623.se
1349517074 gbpln1624.se
1175767295 gbpln1625.se
532052842 gbpln1626.se
1378842693 gbpln1627.se
612033506 gbpln1628.se
1471600767 gbpln1629.se
1444300010 gbpln163.seq
900459075 gbpln1630.se
1480686507 gbpln1631.se
506996792 gbpln1632.se
1474130957 gbpln1633.se
308615956 gbpln1634.se
1480430857 gbpln1635.se
1404650425 gbpln1636.se
1478010619 gbpln1637.se
1498434279 gbpln1638.se
317320398 gbpln1639.se
1491174018 gbpln164.seq
1420113065 gbpln1640.se
627724928 gbpln1641.se
1493522663 gbpln1642.se
1483610634 gbpln1643.se
246413329 gbpln1644.se
1471156732 gbpln1645.se
1011943977 gbpln1646.se
574061324 gbpln1647.se
221798426 gbpln1648.se
1908341558 gbpln1649.se
214449228 gbpln165.seq
1899626925 gbpln1650.se
1507440270 gbpln1651.se
1195338085 gbpln1652.se
1471685919 gbpln1653.se
859088214 gbpln1654.se
1423584097 gbpln1655.se
1398057021 gbpln1656.se
1481929547 gbpln1657.se
256996209 gbpln1658.se
1487433542 gbpln1659.se
1428418672 gbpln166.seq
1109679772 gbpln1660.se
627032043 gbpln1661.se
971627123 gbpln1662.se
850272715 gbpln1663.se
849609082 gbpln1664.se
850190924 gbpln1665.se
976829654 gbpln1666.se
814643125 gbpln1667.se
879514342 gbpln1668.se
812317704 gbpln1669.se
478142784 gbpln167.seq
1488237027 gbpln1670.se
944480603 gbpln1671.se
1488070952 gbpln1672.se
187314210 gbpln1673.se
1498423603 gbpln1674.se
218416733 gbpln1675.se
1441440428 gbpln1676.se
383768559 gbpln1677.se
1224504777 gbpln1678.se
349681340 gbpln1679.se
1497386714 gbpln168.seq
1305247057 gbpln1680.se
762473956 gbpln1681.se
1323225071 gbpln1682.se
1230459038 gbpln1683.se
1375467830 gbpln1684.se
1240461713 gbpln1685.se
819807891 gbpln1686.se
1396293124 gbpln1687.se
219618056 gbpln1688.se
1377479738 gbpln1689.se
351776026 gbpln169.seq
550510508 gbpln1690.se
1497666514 gbpln1691.se
1236193298 gbpln1692.se
591461872 gbpln1693.se
1306797915 gbpln1694.se
419067327 gbpln1695.se
775207534 gbpln1696.se
1225077527 gbpln1697.se
720006493 gbpln1698.se
919172194 gbpln1699.se
1426015771 gbpln17.seq
1495030508 gbpln170.seq
874099561 gbpln1700.se
897784196 gbpln1701.se
876816853 gbpln1702.se
928190368 gbpln1703.se
951802003 gbpln1704.se
824940722 gbpln1705.se
1489306195 gbpln1706.se
1440059389 gbpln1707.se
1482809012 gbpln1708.se
289600562 gbpln1709.se
746896982 gbpln171.seq
1498986385 gbpln1710.se
326817042 gbpln1711.se
1494274713 gbpln1712.se
1340719286 gbpln1713.se
1310386197 gbpln1714.se
1497352310 gbpln1715.se
236596443 gbpln1716.se
1465441556 gbpln1717.se
1028990160 gbpln1718.se
1498394092 gbpln1719.se
1490380028 gbpln172.seq
298447868 gbpln1720.se
1476225239 gbpln1721.se
969829813 gbpln1722.se
1485211048 gbpln1723.se
585500235 gbpln1724.se
1497082384 gbpln1725.se
614807024 gbpln1726.se
1262770835 gbpln1727.se
813125990 gbpln1728.se
1474381949 gbpln1729.se
666076470 gbpln173.seq
701582413 gbpln1730.se
1461709979 gbpln1731.se
1149761834 gbpln1732.se
1483546710 gbpln1733.se
930193039 gbpln1734.se
1489781091 gbpln1735.se
926396631 gbpln1736.se
1495960818 gbpln1737.se
871854711 gbpln1738.se
1473418344 gbpln1739.se
1394326143 gbpln174.seq
1020374305 gbpln1740.se
1424815452 gbpln1741.se
1106391649 gbpln1742.se
1431808111 gbpln1743.se
578207792 gbpln1744.se
1426005868 gbpln1745.se
616258386 gbpln1746.se
1409644052 gbpln1747.se
475108787 gbpln1748.se
1397047033 gbpln1749.se
1109798895 gbpln175.seq
708614105 gbpln1750.se
1403388273 gbpln1751.se
346446930 gbpln1752.se
1407629769 gbpln1753.se
897997916 gbpln1754.se
1493551567 gbpln1755.se
551936404 gbpln1756.se
1473543989 gbpln1757.se
610226278 gbpln1758.se
1319420164 gbpln1759.se
1487556877 gbpln176.seq
363658840 gbpln1760.se
1316361076 gbpln1761.se
879842337 gbpln1762.se
1459253618 gbpln1763.se
503243990 gbpln1764.se
1212625908 gbpln1765.se
1089137212 gbpln1766.se
1364534287 gbpln1767.se
689666779 gbpln1768.se
1494393829 gbpln1769.se
498960662 gbpln177.seq
669973585 gbpln1770.se
203834303 gbpln1771.se
1362396542 gbpln1772.se
1296127754 gbpln1773.se
1242755788 gbpln1774.se
1236451053 gbpln1775.se
1161997091 gbpln1776.se
1077269694 gbpln1777.se
1063032754 gbpln1778.se
1035835981 gbpln1779.se
1463374556 gbpln178.seq
1035095313 gbpln1780.se
1031632940 gbpln1781.se
978747642 gbpln1782.se
979039775 gbpln1783.se
970029823 gbpln1784.se
965223462 gbpln1785.se
968357268 gbpln1786.se
1280849387 gbpln1787.se
328355654 gbpln1788.se
1498338271 gbpln1789.se
614149015 gbpln179.seq
1136660083 gbpln1790.se
1123056907 gbpln1791.se
985246864 gbpln1792.se
1297137158 gbpln1793.se
824265894 gbpln1794.se
1211059423 gbpln1795.se
792576931 gbpln1796.se
1469432556 gbpln1797.se
877257370 gbpln1798.se
1377779858 gbpln1799.se
1118506667 gbpln18.seq
1474182449 gbpln180.seq
706831938 gbpln1800.se
1450681524 gbpln1801.se
811729514 gbpln1802.se
1495564654 gbpln1803.se
640549201 gbpln1804.se
1499997500 gbpln1805.se
552104260 gbpln1806.se
205153230 gbpln181.seq
1478056424 gbpln182.seq
421862769 gbpln183.seq
1497288212 gbpln184.seq
341369167 gbpln185.seq
1491785218 gbpln186.seq
385490861 gbpln187.seq
1226543968 gbpln188.seq
472201904 gbpln189.seq
346201421 gbpln19.seq
1488020108 gbpln190.seq
474707598 gbpln191.seq
1462560050 gbpln192.seq
1465045969 gbpln193.seq
45376924 gbpln194.seq
1471011602 gbpln195.seq
1406572096 gbpln196.seq
1497917594 gbpln197.seq
937502730 gbpln198.seq
1471338906 gbpln199.seq
980467351 gbpln2.seq
385029004 gbpln20.seq
1082634808 gbpln200.seq
1466368251 gbpln201.seq
1045538877 gbpln202.seq
1485205323 gbpln203.seq
565755694 gbpln204.seq
1475774299 gbpln205.seq
847363052 gbpln206.seq
1005396841 gbpln207.seq
963947636 gbpln208.seq
1459631632 gbpln209.seq
205693142 gbpln21.seq
748612126 gbpln210.seq
952879187 gbpln211.seq
925770625 gbpln212.seq
679052523 gbpln213.seq
891360401 gbpln214.seq
983898073 gbpln215.seq
816632077 gbpln216.seq
1120135193 gbpln217.seq
972749686 gbpln218.seq
850229174 gbpln219.seq
85942797 gbpln22.seq
1055433660 gbpln220.seq
1010018946 gbpln221.seq
649020564 gbpln222.seq
926976142 gbpln223.seq
1412030056 gbpln224.seq
1012598905 gbpln225.seq
1480976754 gbpln226.seq
464336268 gbpln227.seq
1354222615 gbpln228.seq
930875701 gbpln229.seq
1499912583 gbpln23.seq
1373508522 gbpln230.seq
650922585 gbpln231.seq
1430360286 gbpln232.seq
715204913 gbpln233.seq
1486817696 gbpln234.seq
714902212 gbpln235.seq
1499652750 gbpln236.seq
225802062 gbpln237.seq
1490234762 gbpln238.seq
242224687 gbpln239.seq
300458283 gbpln24.seq
1482658271 gbpln240.seq
206514537 gbpln241.seq
1438719136 gbpln242.seq
352722965 gbpln243.seq
1496421172 gbpln244.seq
191652670 gbpln245.seq
1491874983 gbpln246.seq
504402793 gbpln247.seq
1489874495 gbpln248.seq
353869911 gbpln249.seq
1498951977 gbpln25.seq
1477154910 gbpln250.seq
821110847 gbpln251.seq
1466146568 gbpln252.seq
826413489 gbpln253.seq
1496321685 gbpln254.seq
771101605 gbpln255.seq
1446823294 gbpln256.seq
858389248 gbpln257.seq
1486723401 gbpln258.seq
318943146 gbpln259.seq
100249219 gbpln26.seq
86418 gbpln260.seq
361751 gbpln261.seq
164981114 gbpln262.seq
40089681 gbpln263.seq
74918158 gbpln264.seq
858233872 gbpln265.seq
1144429862 gbpln266.seq
1499958825 gbpln267.seq
291165259 gbpln268.seq
298903110 gbpln269.seq
1359300905 gbpln27.seq
211513048 gbpln270.seq
248676645 gbpln271.seq
1239599711 gbpln272.seq
1434095839 gbpln273.seq
636195341 gbpln274.seq
1474382844 gbpln275.seq
609356119 gbpln276.seq
786074578 gbpln277.seq
733167229 gbpln278.seq
1427815214 gbpln279.seq
1435397000 gbpln28.seq
1497769109 gbpln280.seq
785185481 gbpln281.seq
566724302 gbpln282.seq
1272857016 gbpln283.seq
1094535418 gbpln284.seq
985321803 gbpln285.seq
921913774 gbpln286.seq
891711439 gbpln287.seq
1499999648 gbpln288.seq
73358963 gbpln289.seq
1467918137 gbpln29.seq
1424145394 gbpln290.seq
1499128804 gbpln291.seq
597113524 gbpln292.seq
1394284542 gbpln293.seq
951403028 gbpln294.seq
719212260 gbpln295.seq
981097867 gbpln296.seq
860028189 gbpln297.seq
800605872 gbpln298.seq
794469115 gbpln299.seq
1226309192 gbpln3.seq
1035036640 gbpln30.seq
1492903391 gbpln300.seq
1017587761 gbpln301.seq
924325157 gbpln302.seq
1201978654 gbpln303.seq
1227268207 gbpln304.seq
1152253241 gbpln305.seq
1115248374 gbpln306.seq
1125506105 gbpln307.seq
1145303472 gbpln308.seq
1479141557 gbpln309.seq
1478161497 gbpln31.seq
324547157 gbpln310.seq
1477277159 gbpln311.seq
407347304 gbpln312.seq
117077962 gbpln313.seq
1328532546 gbpln314.seq
887561680 gbpln315.seq
834970472 gbpln316.seq
826391913 gbpln317.seq
792513917 gbpln318.seq
743209872 gbpln319.seq
718759820 gbpln32.seq
1498927742 gbpln320.seq
860028189 gbpln321.seq
800605872 gbpln322.seq
794469115 gbpln323.seq
1492903391 gbpln324.seq
997390720 gbpln325.seq
663098252 gbpln326.seq
855592604 gbpln327.seq
807031053 gbpln328.seq
793905039 gbpln329.seq
172902778 gbpln33.seq
1491456147 gbpln330.seq
1466632070 gbpln331.seq
840180304 gbpln332.seq
796430245 gbpln333.seq
779180715 gbpln334.seq
1486604510 gbpln335.seq
1445385427 gbpln336.seq
831209396 gbpln337.seq
783682955 gbpln338.seq
775938782 gbpln339.seq
1415084627 gbpln34.seq
1442399440 gbpln340.seq
1471877377 gbpln341.seq
872662143 gbpln342.seq
815663229 gbpln343.seq
813528167 gbpln344.seq
780491844 gbpln345.seq
734904793 gbpln346.seq
816941948 gbpln347.seq
1459223663 gbpln348.seq
768070182 gbpln349.seq
555810468 gbpln35.seq
1491145948 gbpln350.seq
706311232 gbpln351.seq
1417708310 gbpln352.seq
830082304 gbpln353.seq
783385752 gbpln354.seq
770520351 gbpln355.seq
753421970 gbpln356.seq
1483888921 gbpln357.seq
702337808 gbpln358.seq
906907390 gbpln359.seq
1497609858 gbpln36.seq
844110716 gbpln360.seq
841780855 gbpln361.seq
805270043 gbpln362.seq
764396863 gbpln363.seq
841492595 gbpln364.seq
714482811 gbpln365.seq
916127997 gbpln366.seq
858459407 gbpln367.seq
848936990 gbpln368.seq
813129213 gbpln369.seq
695384158 gbpln37.seq
765593150 gbpln370.seq
862731158 gbpln371.seq
665885634 gbpln372.seq
854365265 gbpln373.seq
802776346 gbpln374.seq
793295912 gbpln375.seq
769246240 gbpln376.seq
710912919 gbpln377.seq
1429544600 gbpln378.seq
814320946 gbpln379.seq
1495430424 gbpln38.seq
759349720 gbpln380.seq
762512207 gbpln381.seq
1404327068 gbpln382.seq
1468493398 gbpln383.seq
873292213 gbpln384.seq
827422505 gbpln385.seq
815925825 gbpln386.seq
779009585 gbpln387.seq
739747654 gbpln388.seq
1498046242 gbpln389.seq
489283076 gbpln39.seq
849628701 gbpln390.seq
803882830 gbpln391.seq
794420470 gbpln392.seq
760127459 gbpln393.seq
714663802 gbpln394.seq
1469965572 gbpln395.seq
854770002 gbpln396.seq
805931576 gbpln397.seq
798923954 gbpln398.seq
1489544894 gbpln399.seq
769118105 gbpln4.seq
1488044778 gbpln40.seq
1467528130 gbpln400.seq
854339916 gbpln401.seq
803900400 gbpln402.seq
791449620 gbpln403.seq
1476207543 gbpln404.seq
1475343864 gbpln405.seq
870939392 gbpln406.seq
809408813 gbpln407.seq
801514137 gbpln408.seq
1492438448 gbpln409.seq
1179554406 gbpln41.seq
1476330312 gbpln410.seq
846934671 gbpln411.seq
794708793 gbpln412.seq
789781753 gbpln413.seq
1475691254 gbpln414.seq
1489470879 gbpln415.seq
888406351 gbpln416.seq
835271741 gbpln417.seq
823533989 gbpln418.seq
787819193 gbpln419.seq
1445386724 gbpln42.seq
748786657 gbpln420.seq
1483648703 gbpln421.seq
283001912 gbpln422.seq
914557940 gbpln423.seq
898446949 gbpln424.seq
628489896 gbpln425.seq
1024113089 gbpln426.seq
1032878661 gbpln427.seq
858694781 gbpln428.seq
960391204 gbpln429.seq
1421332480 gbpln43.seq
1090094606 gbpln430.seq
781959143 gbpln431.seq
946995961 gbpln432.seq
857542781 gbpln433.seq
656405285 gbpln434.seq
907889097 gbpln435.seq
896386890 gbpln436.seq
726432335 gbpln437.seq
798296822 gbpln438.seq
918393750 gbpln439.seq
966355920 gbpln44.seq
584961784 gbpln440.seq
948865971 gbpln441.seq
954536271 gbpln442.seq
819735731 gbpln443.seq
756588093 gbpln444.seq
876067119 gbpln445.seq
625446321 gbpln446.seq
977801494 gbpln447.seq
854357980 gbpln448.seq
807732556 gbpln449.seq
1256255782 gbpln45.seq
947696453 gbpln450.seq
1067629605 gbpln451.seq
822222048 gbpln452.seq
950272996 gbpln453.seq
1488985571 gbpln454.seq
894745096 gbpln455.seq
893352134 gbpln456.seq
1498806035 gbpln457.seq
1491810166 gbpln458.seq
933986451 gbpln459.seq
376172115 gbpln46.seq
939527664 gbpln460.seq
810117922 gbpln461.seq
765938558 gbpln462.seq
886537018 gbpln463.seq
623519964 gbpln464.seq
996940649 gbpln465.seq
1030190034 gbpln466.seq
832828033 gbpln467.seq
956342979 gbpln468.seq
1134286144 gbpln469.seq
1469659294 gbpln47.seq
790513299 gbpln470.seq
944161893 gbpln471.seq
860035788 gbpln472.seq
647268685 gbpln473.seq
902239623 gbpln474.seq
1345936752 gbpln475.seq
787834228 gbpln476.seq
910724363 gbpln477.seq
606016896 gbpln478.seq
961485234 gbpln479.seq
320290805 gbpln48.seq
1242775191 gbpln480.seq
1453328788 gbpln481.seq
818591771 gbpln482.seq
766580884 gbpln483.seq
752100829 gbpln484.seq
1415475376 gbpln485.seq
769738288 gbpln486.seq
750738544 gbpln487.seq
1496665003 gbpln488.seq
995069022 gbpln489.seq
1485324492 gbpln49.seq
1012956234 gbpln490.seq
827074347 gbpln491.seq
940621783 gbpln492.seq
1079418810 gbpln493.seq
776922106 gbpln494.seq
938380968 gbpln495.seq
1492330319 gbpln496.seq
891714442 gbpln497.seq
878638403 gbpln498.seq
721632671 gbpln499.seq
1468706699 gbpln5.seq
199854535 gbpln50.seq
779156122 gbpln500.seq
895553446 gbpln501.seq
604678568 gbpln502.seq
931006295 gbpln503.seq
933660027 gbpln504.seq
810459540 gbpln505.seq
761872100 gbpln506.seq
878702815 gbpln507.seq
627081460 gbpln508.seq
994320235 gbpln509.seq
1499992872 gbpln51.seq
999434327 gbpln510.seq
823789349 gbpln511.seq
945629782 gbpln512.seq
1062113821 gbpln513.seq
792298939 gbpln514.seq
941851700 gbpln515.seq
850142413 gbpln516.seq
656955691 gbpln517.seq
904094753 gbpln518.seq
900193903 gbpln519.seq
647179239 gbpln52.seq
1470079206 gbpln520.seq
1497721340 gbpln521.seq
937117048 gbpln522.seq
936021119 gbpln523.seq
812696702 gbpln524.seq
746628212 gbpln525.seq
897168807 gbpln526.seq
626698501 gbpln527.seq
1007072101 gbpln528.seq
1000831797 gbpln529.seq
1361184932 gbpln53.seq
841918855 gbpln530.seq
963426816 gbpln531.seq
1093654114 gbpln532.seq
791118382 gbpln533.seq
959940756 gbpln534.seq
853263842 gbpln535.seq
648051398 gbpln536.seq
901282075 gbpln537.seq
923491092 gbpln538.seq
732477869 gbpln539.seq
1015832925 gbpln54.seq
789987733 gbpln540.seq
926022053 gbpln541.seq
610840579 gbpln542.seq
949759032 gbpln543.seq
955444559 gbpln544.seq
818480442 gbpln545.seq
752251380 gbpln546.seq
897893149 gbpln547.seq
631111272 gbpln548.seq
1022032953 gbpln549.seq
1424618977 gbpln55.seq
1006306956 gbpln550.seq
837035085 gbpln551.seq
966140819 gbpln552.seq
1090560006 gbpln553.seq
800164754 gbpln554.seq
959884028 gbpln555.seq
886916735 gbpln556.seq
641540050 gbpln557.seq
910168783 gbpln558.seq
908785549 gbpln559.seq
833282640 gbpln56.seq
729527181 gbpln560.seq
797552105 gbpln561.seq
910975470 gbpln562.seq
616026199 gbpln563.seq
945685366 gbpln564.seq
953145956 gbpln565.seq
820081609 gbpln566.seq
763165947 gbpln567.seq
1489098826 gbpln568.seq
1009123187 gbpln569.seq
1497082782 gbpln57.seq
1016689515 gbpln570.seq
832912303 gbpln571.seq
952656374 gbpln572.seq
1065835283 gbpln573.seq
776075044 gbpln574.seq
935940025 gbpln575.seq
1488231655 gbpln576.seq
1487557825 gbpln577.seq
720169483 gbpln578.seq
780564861 gbpln579.seq
319206973 gbpln58.seq
1499144496 gbpln580.seq
934713391 gbpln581.seq
1233388213 gbpln582.seq
807542511 gbpln583.seq
757881986 gbpln584.seq
889760627 gbpln585.seq
635890046 gbpln586.seq
1007873898 gbpln587.seq
1015524558 gbpln588.seq
836625022 gbpln589.seq
1498927430 gbpln59.seq
959076059 gbpln590.seq
1077416379 gbpln591.seq
789416089 gbpln592.seq
958430056 gbpln593.seq
877922843 gbpln594.seq
648665455 gbpln595.seq
907513209 gbpln596.seq
904978028 gbpln597.seq
727024880 gbpln598.seq
789120540 gbpln599.seq
170607031 gbpln6.seq
931856203 gbpln60.seq
898507915 gbpln600.seq
617229811 gbpln601.seq
942711764 gbpln602.seq
964780021 gbpln603.seq
818917331 gbpln604.seq
755294557 gbpln605.seq
882064051 gbpln606.seq
627203691 gbpln607.seq
993595919 gbpln608.seq
1021497440 gbpln609.seq
1495942547 gbpln61.seq
827286497 gbpln610.seq
962451301 gbpln611.seq
1082256067 gbpln612.seq
781463827 gbpln613.seq
919665368 gbpln614.seq
1497522046 gbpln615.seq
905574854 gbpln616.seq
906714977 gbpln617.seq
718743537 gbpln618.seq
787529633 gbpln619.seq
581614185 gbpln62.seq
910251919 gbpln620.seq
608518276 gbpln621.seq
934541265 gbpln622.seq
954054955 gbpln623.seq
806443717 gbpln624.seq
1009766480 gbpln625.seq
1318260463 gbpln626.seq
1253136609 gbpln627.seq
1066198175 gbpln628.seq
1119572655 gbpln629.seq
1498805571 gbpln63.seq
1040217505 gbpln630.seq
1310077288 gbpln631.seq
955690374 gbpln632.seq
1230684440 gbpln633.seq
1179787958 gbpln634.seq
1125383520 gbpln635.seq
1051194518 gbpln636.seq
965656648 gbpln637.seq
1110314387 gbpln638.seq
907449503 gbpln639.seq
278927988 gbpln64.seq
843080362 gbpln640.seq
787261705 gbpln641.seq
773098599 gbpln642.seq
1456694585 gbpln643.seq
801494093 gbpln644.seq
1340425536 gbpln645.seq
507333599 gbpln646.seq
1445293885 gbpln647.seq
1219201533 gbpln648.seq
1281941476 gbpln649.seq
1480521511 gbpln65.seq
1465910871 gbpln650.seq
9838016 gbpln651.seq
1332978291 gbpln652.seq
756143249 gbpln653.seq
878426054 gbpln654.seq
631056251 gbpln655.seq
993852367 gbpln656.seq
1020132695 gbpln657.seq
830166807 gbpln658.seq
955723315 gbpln659.seq
1133270019 gbpln66.seq
1057964328 gbpln660.seq
784007552 gbpln661.seq
947940191 gbpln662.seq
857511193 gbpln663.seq
649137171 gbpln664.seq
903393879 gbpln665.seq
908180396 gbpln666.seq
721135945 gbpln667.seq
786739709 gbpln668.seq
918070756 gbpln669.seq
1473698497 gbpln67.seq
603192844 gbpln670.seq
938102555 gbpln671.seq
955978436 gbpln672.seq
1498148789 gbpln673.seq
423921777 gbpln674.seq
1018937906 gbpln675.seq
768159651 gbpln676.seq
891261263 gbpln677.seq
1017239134 gbpln678.seq
1036737053 gbpln679.seq
405522101 gbpln68.seq
980587319 gbpln680.seq
1096962209 gbpln681.seq
964715275 gbpln682.seq
883795567 gbpln683.seq
879409471 gbpln684.seq
922242639 gbpln685.seq
805484043 gbpln686.seq
912391541 gbpln687.seq
954577618 gbpln688.seq
974130060 gbpln689.seq
1495859265 gbpln69.seq
404921601 gbpln690.seq
1489938473 gbpln691.seq
1499999024 gbpln692.seq
91141822 gbpln693.seq
1499999155 gbpln694.seq
327625089 gbpln695.seq
1499862384 gbpln696.seq
32988520 gbpln697.seq
1499730109 gbpln698.seq
189675340 gbpln699.seq
1484572601 gbpln7.seq
603645746 gbpln70.seq
1499940568 gbpln700.seq
1185526387 gbpln701.seq
1499997692 gbpln702.seq
421131541 gbpln703.seq
1499595568 gbpln704.seq
615797312 gbpln705.seq
1499816463 gbpln706.seq
431779238 gbpln707.seq
1499927389 gbpln708.seq
1075525817 gbpln709.seq
1498515316 gbpln71.seq
674055631 gbpln710.seq
865045961 gbpln711.seq
815791689 gbpln712.seq
802718902 gbpln713.seq
776304595 gbpln714.seq
721531499 gbpln715.seq
1489200818 gbpln716.seq
873797632 gbpln717.seq
820367220 gbpln718.seq
806296382 gbpln719.seq
1308695072 gbpln72.seq
775209384 gbpln720.seq
744231520 gbpln721.seq
817156402 gbpln722.seq
771380170 gbpln723.seq
913253142 gbpln724.seq
634934982 gbpln725.seq
1019175188 gbpln726.seq
1023638564 gbpln727.seq
822225605 gbpln728.seq
961290952 gbpln729.seq
1356426063 gbpln73.seq
1090804562 gbpln730.seq
813694518 gbpln731.seq
962545328 gbpln732.seq
873725319 gbpln733.seq
673190932 gbpln734.seq
905064826 gbpln735.seq
908590682 gbpln736.seq
742712720 gbpln737.seq
793279946 gbpln738.seq
934932909 gbpln739.seq
1479480118 gbpln74.seq
640700840 gbpln740.seq
961568346 gbpln741.seq
952066709 gbpln742.seq
1470907411 gbpln743.seq
1315696038 gbpln744.seq
1451561486 gbpln745.seq
1409767917 gbpln746.seq
605149309 gbpln747.seq
1109188510 gbpln748.seq
1170981868 gbpln749.seq
1319684527 gbpln75.seq
609718059 gbpln750.seq
1136119548 gbpln751.seq
1284507799 gbpln752.seq
1122567296 gbpln753.seq
1192074506 gbpln754.seq
1181896740 gbpln755.seq
692441980 gbpln756.seq
738372777 gbpln757.seq
858786663 gbpln758.seq
1482575758 gbpln759.seq
451516766 gbpln76.seq
1256005171 gbpln760.seq
1249214474 gbpln761.seq
1164522681 gbpln762.seq
1002097666 gbpln763.seq
1300955592 gbpln764.seq
1317957634 gbpln765.seq
1148040939 gbpln766.seq
1403417765 gbpln767.seq
1375754075 gbpln768.seq
745221978 gbpln769.seq
1499422292 gbpln77.seq
1286273263 gbpln770.seq
1222805283 gbpln771.seq
738102834 gbpln772.seq
1300107704 gbpln773.seq
1290738490 gbpln774.seq
682607984 gbpln775.seq
777312364 gbpln776.seq
1006352199 gbpln777.seq
962815279 gbpln778.seq
975138624 gbpln779.seq
1070174241 gbpln78.seq
906550423 gbpln780.seq
790269619 gbpln781.seq
956926034 gbpln782.seq
908369814 gbpln783.seq
1035806383 gbpln784.seq
1095241384 gbpln785.seq
889046375 gbpln786.seq
920177986 gbpln787.seq
934896187 gbpln788.seq
972756494 gbpln789.seq
1477754554 gbpln79.seq
639243888 gbpln790.seq
839211114 gbpln791.seq
1479400215 gbpln792.seq
1382640922 gbpln793.seq
1372701817 gbpln794.seq
738741167 gbpln795.seq
1194847682 gbpln796.seq
449429603 gbpln797.seq
1408878447 gbpln798.seq
1491657383 gbpln799.seq
984218119 gbpln8.seq
1446433546 gbpln80.seq
271440721 gbpln800.seq
1477932248 gbpln801.seq
1257530871 gbpln802.seq
1466995802 gbpln803.seq
1437909873 gbpln804.seq
1307026425 gbpln805.seq
1462620068 gbpln806.seq
1087730235 gbpln807.seq
1451936168 gbpln808.seq
890586335 gbpln809.seq
1426285617 gbpln81.seq
628166165 gbpln810.seq
1008494769 gbpln811.seq
987228439 gbpln812.seq
843057145 gbpln813.seq
959088226 gbpln814.seq
1080118899 gbpln815.seq
790032688 gbpln816.seq
943744807 gbpln817.seq
858758922 gbpln818.seq
664109823 gbpln819.seq
455557137 gbpln82.seq
920678547 gbpln820.seq
888501596 gbpln821.seq
739915903 gbpln822.seq
788736235 gbpln823.seq
944601114 gbpln824.seq
621465898 gbpln825.seq
948555730 gbpln826.seq
954911742 gbpln827.seq
854893508 gbpln828.seq
752395251 gbpln829.seq
1494370143 gbpln83.seq
890282441 gbpln830.seq
626588937 gbpln831.seq
1004358313 gbpln832.seq
1028945402 gbpln833.seq
838465030 gbpln834.seq
950517847 gbpln835.seq
1082441570 gbpln836.seq
789583361 gbpln837.seq
950035125 gbpln838.seq
853507173 gbpln839.seq
1362784512 gbpln84.seq
659807142 gbpln840.seq
902654821 gbpln841.seq
890952839 gbpln842.seq
721824594 gbpln843.seq
785634142 gbpln844.seq
909002040 gbpln845.seq
625532225 gbpln846.seq
945667284 gbpln847.seq
953425672 gbpln848.seq
871481257 gbpln849.seq
537903618 gbpln85.seq
1254084023 gbpln850.seq
1125916060 gbpln851.seq
614750080 gbpln852.seq
1193223709 gbpln853.seq
1332440485 gbpln854.seq
808684469 gbpln855.seq
907082918 gbpln856.seq
776688264 gbpln857.seq
1492098096 gbpln858.seq
1287386861 gbpln859.seq
1396494473 gbpln86.seq
609236734 gbpln860.seq
1209159954 gbpln861.seq
377507568 gbpln862.seq
1484585650 gbpln863.seq
946681452 gbpln864.seq
950480218 gbpln865.seq
890282441 gbpln866.seq
626588937 gbpln867.seq
1004358313 gbpln868.seq
1028945402 gbpln869.seq
684881209 gbpln87.seq
838465030 gbpln870.seq
950517847 gbpln871.seq
1082441570 gbpln872.seq
789583361 gbpln873.seq
950035125 gbpln874.seq
853507173 gbpln875.seq
659807142 gbpln876.seq
902654821 gbpln877.seq
890952839 gbpln878.seq
721824594 gbpln879.seq
1255396237 gbpln88.seq
785634142 gbpln880.seq
909002040 gbpln881.seq
625532225 gbpln882.seq
945667284 gbpln883.seq
953425672 gbpln884.seq
1496388051 gbpln885.seq
660322436 gbpln886.seq
841140962 gbpln887.seq
1479991498 gbpln888.seq
1471774772 gbpln889.seq
644937327 gbpln89.seq
801426109 gbpln890.seq
1497825120 gbpln891.seq
1107189955 gbpln892.seq
1490655990 gbpln893.seq
1128106750 gbpln894.seq
1466437965 gbpln895.seq
1161000777 gbpln896.seq
1423880580 gbpln897.seq
1214063491 gbpln898.seq
1451396326 gbpln899.seq
1467665665 gbpln9.seq
1477669894 gbpln90.seq
534355433 gbpln900.seq
1473756313 gbpln901.seq
1289061621 gbpln902.seq
1409268379 gbpln903.seq
1413747761 gbpln904.seq
509646630 gbpln905.seq
1495475780 gbpln906.seq
527957373 gbpln907.seq
1476848943 gbpln908.seq
399443329 gbpln909.seq
1486392850 gbpln91.seq
1368729073 gbpln910.seq
555294430 gbpln911.seq
1450863217 gbpln912.seq
1426917875 gbpln913.seq
310654352 gbpln914.seq
1384718199 gbpln915.seq
535518402 gbpln916.seq
1476837338 gbpln917.seq
723858950 gbpln918.seq
759028695 gbpln919.seq
149356615 gbpln92.seq
898515506 gbpln920.seq
632797874 gbpln921.seq
1008257523 gbpln922.seq
1024893589 gbpln923.seq
849343329 gbpln924.seq
961475028 gbpln925.seq
1105697901 gbpln926.seq
806976002 gbpln927.seq
970149905 gbpln928.seq
872154954 gbpln929.seq
1263909550 gbpln93.seq
676154112 gbpln930.seq
905516393 gbpln931.seq
922918521 gbpln932.seq
742368603 gbpln933.seq
788401116 gbpln934.seq
929538621 gbpln935.seq
641895628 gbpln936.seq
961976136 gbpln937.seq
973033369 gbpln938.seq
834845237 gbpln939.seq
753151985 gbpln94.seq
1096228945 gbpln940.seq
1065747701 gbpln941.seq
978382753 gbpln942.seq
970377845 gbpln943.seq
932157797 gbpln944.seq
878151180 gbpln945.seq
874085481 gbpln946.seq
829265282 gbpln947.seq
863296712 gbpln948.seq
823515696 gbpln949.seq
1488086519 gbpln95.seq
815413878 gbpln950.seq
1384284611 gbpln951.seq
669344398 gbpln952.seq
1299578188 gbpln953.seq
613278883 gbpln954.seq
541733671 gbpln955.seq
2012725364 gbpln956.seq
2313576156 gbpln957.seq
2199353950 gbpln958.seq
2096617948 gbpln959.seq
1407723759 gbpln96.seq
2106642320 gbpln960.seq
1745413839 gbpln961.seq
1943630373 gbpln962.seq
43805281 gbpln963.seq
1052364780 gbpln964.seq
836152673 gbpln965.seq
790234194 gbpln966.seq
768134126 gbpln967.seq
1464177021 gbpln968.seq
794343594 gbpln969.seq
1494162414 gbpln97.seq
1499805858 gbpln970.seq
794136795 gbpln971.seq
777214951 gbpln972.seq
750731320 gbpln973.seq
709232632 gbpln974.seq
1453910479 gbpln975.seq
831555004 gbpln976.seq
787385081 gbpln977.seq
774061568 gbpln978.seq
1444041489 gbpln979.seq
651907412 gbpln98.seq
1462025010 gbpln980.seq
837904862 gbpln981.seq
793009108 gbpln982.seq
770582515 gbpln983.seq
1458992600 gbpln984.seq
809917662 gbpln985.seq
662753084 gbpln986.seq
837974598 gbpln987.seq
802983165 gbpln988.seq
776399714 gbpln989.seq
1490193530 gbpln99.seq
749269997 gbpln990.seq
1498103845 gbpln991.seq
672385034 gbpln992.seq
841987686 gbpln993.seq
800255273 gbpln994.seq
776782162 gbpln995.seq
765490377 gbpln996.seq
737409430 gbpln997.seq
1467554404 gbpln998.seq
838067528 gbpln999.seq
148378965 gbpri1.seq
1365064130 gbpri10.seq
1336019423 gbpri11.seq
1499996596 gbpri12.seq
227230043 gbpri13.seq
1495617045 gbpri14.seq
1488562552 gbpri15.seq
1255994844 gbpri16.seq
1152823208 gbpri17.seq
1461561062 gbpri18.seq
1327607251 gbpri19.seq
1499937628 gbpri2.seq
1367999520 gbpri20.seq
1248237867 gbpri21.seq
1458616828 gbpri22.seq
1406973575 gbpri23.seq
353371961 gbpri24.seq
1457966298 gbpri25.seq
1499973379 gbpri26.seq
247223946 gbpri27.seq
1316571438 gbpri28.seq
1330311514 gbpri29.seq
892961995 gbpri3.seq
1499985098 gbpri30.seq
131341555 gbpri31.seq
1498948252 gbpri32.seq
543853141 gbpri33.seq
1484623677 gbpri34.seq
1179133143 gbpri35.seq
1499754625 gbpri4.seq
1248674023 gbpri5.seq
852828719 gbpri6.seq
162657269 gbpri7.seq
494738393 gbpri8.seq
1499996495 gbpri9.seq
798366 gbrel.txt
1499874179 gbrod1.seq
1364606089 gbrod10.seq
720172269 gbrod100.seq
1339278647 gbrod101.seq
611593151 gbrod102.seq
1419645093 gbrod103.seq
1209757347 gbrod104.seq
1441818101 gbrod105.seq
1396178967 gbrod106.seq
1351873160 gbrod107.seq
846383607 gbrod108.seq
1433880689 gbrod109.seq
967058320 gbrod11.seq
874097174 gbrod110.seq
1465720088 gbrod111.seq
771726132 gbrod112.seq
1452944377 gbrod113.seq
895279721 gbrod114.seq
1452029513 gbrod115.seq
1391575060 gbrod116.seq
254113502 gbrod117.seq
1384329105 gbrod118.seq
1452389530 gbrod119.seq
1478819696 gbrod12.seq
208544704 gbrod120.seq
1344528666 gbrod121.seq
368365640 gbrod122.seq
1429465167 gbrod123.seq
482188106 gbrod124.seq
1431602397 gbrod125.seq
1463131664 gbrod126.seq
432802053 gbrod127.seq
1281943162 gbrod128.seq
643998178 gbrod129.seq
1164340164 gbrod13.seq
1483797372 gbrod130.seq
424925507 gbrod131.seq
1365976721 gbrod14.seq
782037687 gbrod15.seq
1432583977 gbrod16.seq
672937827 gbrod17.seq
1471007422 gbrod18.seq
701368584 gbrod19.seq
1079954021 gbrod2.seq
1485666339 gbrod20.seq
1040471061 gbrod21.seq
1390188394 gbrod22.seq
1351534647 gbrod23.seq
1379133925 gbrod24.seq
1090402714 gbrod25.seq
1351547492 gbrod26.seq
1434496523 gbrod27.seq
1387638765 gbrod28.seq
774513298 gbrod29.seq
1499842037 gbrod3.seq
1483025748 gbrod30.seq
1275849540 gbrod31.seq
1443775129 gbrod32.seq
1396087823 gbrod33.seq
1464212638 gbrod34.seq
1390894064 gbrod35.seq
1457113534 gbrod36.seq
1483189817 gbrod37.seq
1493035007 gbrod38.seq
1319919002 gbrod39.seq
505728335 gbrod4.seq
424097301 gbrod40.seq
1403617701 gbrod41.seq
1477924977 gbrod42.seq
199611565 gbrod43.seq
1401494568 gbrod44.seq
1388903637 gbrod45.seq
310706546 gbrod46.seq
1400027325 gbrod47.seq
1461603649 gbrod48.seq
225065456 gbrod49.seq
703743518 gbrod5.seq
1424745702 gbrod50.seq
1284962968 gbrod51.seq
469102684 gbrod52.seq
1438575392 gbrod53.seq
867442690 gbrod54.seq
1454936442 gbrod55.seq
850383541 gbrod56.seq
1281522937 gbrod57.seq
1040847553 gbrod58.seq
1451446756 gbrod59.seq
1499997004 gbrod6.seq
938452301 gbrod60.seq
1372874755 gbrod61.seq
1447005896 gbrod62.seq
185502754 gbrod63.seq
1457502126 gbrod64.seq
1386330563 gbrod65.seq
341028443 gbrod66.seq
1460394982 gbrod67.seq
732581516 gbrod68.seq
1350711034 gbrod69.seq
296702087 gbrod7.seq
1110791481 gbrod70.seq
1458676727 gbrod71.seq
822767134 gbrod72.seq
1418746662 gbrod73.seq
1300599839 gbrod74.seq
238222177 gbrod75.seq
1488562555 gbrod76.seq
883469325 gbrod77.seq
1313917093 gbrod78.seq
1160876670 gbrod79.seq
1350781520 gbrod8.seq
1439974119 gbrod80.seq
959839077 gbrod81.seq
1372051537 gbrod82.seq
1349923280 gbrod83.seq
233816573 gbrod84.seq
1371052535 gbrod85.seq
1330597820 gbrod86.seq
1444437216 gbrod87.seq
1290357211 gbrod88.seq
1392442820 gbrod89.seq
947353795 gbrod9.seq
1226020574 gbrod90.seq
1330212561 gbrod91.seq
1447730182 gbrod92.seq
1312689954 gbrod93.seq
1236107954 gbrod94.seq
1474471846 gbrod95.seq
1348543734 gbrod96.seq
1432083992 gbrod97.seq
665823558 gbrod98.seq
1411009597 gbrod99.seq
1038366811 gbsts1.seq
1456731839 gbsts2.seq
1021008875 gbsts3.seq
933661665 gbsts4.seq
1434571525 gbsyn1.seq
1499993279 gbsyn10.seq
737417313 gbsyn11.seq
529690086 gbsyn2.seq
1300574768 gbsyn3.seq
1146591620 gbsyn4.seq
1474499579 gbsyn5.seq
976985325 gbsyn6.seq
1363478755 gbsyn7.seq
1492035277 gbsyn8.seq
601998146 gbsyn9.seq
1148637248 gbtsa1.seq
284915211 gbtsa10.seq
1078282558 gbtsa11.seq
1160611678 gbtsa12.seq
1499998892 gbtsa13.seq
493076220 gbtsa14.seq
1499998876 gbtsa15.seq
229221287 gbtsa16.seq
1499999292 gbtsa17.seq
177771736 gbtsa18.seq
1356238486 gbtsa19.seq
1058521133 gbtsa2.seq
1298590575 gbtsa20.seq
1403398524 gbtsa21.seq
1499999131 gbtsa22.seq
344163063 gbtsa23.seq
1499994897 gbtsa24.seq
226458532 gbtsa25.seq
1261844914 gbtsa26.seq
964262293 gbtsa27.seq
1499995706 gbtsa28.seq
169680885 gbtsa29.seq
1275208228 gbtsa3.seq
1499998595 gbtsa30.seq
4102913 gbtsa31.seq
1131896222 gbtsa32.seq
1034997215 gbtsa33.seq
1499999757 gbtsa34.seq
548834050 gbtsa35.seq
1499999929 gbtsa36.seq
83124167 gbtsa37.seq
890368532 gbtsa38.seq
1499999968 gbtsa39.seq
1280573016 gbtsa4.seq
208341348 gbtsa40.seq
1499998117 gbtsa41.seq
231644928 gbtsa42.seq
1499995826 gbtsa43.seq
406136180 gbtsa44.seq
1499995959 gbtsa45.seq
474066476 gbtsa46.seq
1233496619 gbtsa47.seq
1499996137 gbtsa48.seq
534143574 gbtsa49.seq
1161955992 gbtsa5.seq
1500000002 gbtsa50.seq
470649008 gbtsa51.seq
1499998760 gbtsa52.seq
280311424 gbtsa53.seq
1499999355 gbtsa54.seq
423253259 gbtsa55.seq
1261020148 gbtsa6.seq
1499998007 gbtsa7.seq
72685185 gbtsa8.seq
1499998599 gbtsa9.seq
7358236 gbuna1.seq
1499987834 gbvrl1.seq
1374099993 gbvrl10.seq
1499956396 gbvrl100.seq
784230616 gbvrl101.seq
1499943782 gbvrl102.seq
774917773 gbvrl103.seq
1499996850 gbvrl104.seq
739586433 gbvrl105.seq
1499974942 gbvrl106.seq
763256824 gbvrl107.seq
1499956933 gbvrl108.seq
764467458 gbvrl109.seq
1318343256 gbvrl11.seq
1499950963 gbvrl110.seq
764064330 gbvrl111.seq
1499988232 gbvrl112.seq
137582072 gbvrl113.seq
1499958706 gbvrl114.seq
146322924 gbvrl115.seq
1499944532 gbvrl116.seq
1499969568 gbvrl117.seq
245878149 gbvrl118.seq
1499962296 gbvrl119.seq
1499998959 gbvrl12.seq
754826231 gbvrl120.seq
1499959691 gbvrl121.seq
763064664 gbvrl122.seq
1499976648 gbvrl123.seq
921483576 gbvrl124.seq
1499941348 gbvrl125.seq
167053039 gbvrl126.seq
1499942052 gbvrl127.seq
228344970 gbvrl128.seq
1499988374 gbvrl129.seq
422771196 gbvrl13.seq
309551076 gbvrl130.seq
1499991245 gbvrl131.seq
269288154 gbvrl132.seq
1499959169 gbvrl133.seq
373017560 gbvrl134.seq
1499946259 gbvrl135.seq
386450807 gbvrl136.seq
1499969203 gbvrl137.seq
526735243 gbvrl138.seq
1499997446 gbvrl139.seq
1436701574 gbvrl14.seq
270359990 gbvrl140.seq
1499980507 gbvrl141.seq
249012039 gbvrl142.seq
1499945415 gbvrl143.seq
165359318 gbvrl144.seq
1499938312 gbvrl145.seq
570988547 gbvrl146.seq
1499940482 gbvrl147.seq
464760376 gbvrl148.seq
1499998417 gbvrl149.seq
1437665748 gbvrl15.seq
502381199 gbvrl150.seq
1499994701 gbvrl151.seq
648046373 gbvrl152.seq
1499952694 gbvrl153.seq
191163816 gbvrl154.seq
1499985225 gbvrl155.seq
452085105 gbvrl156.seq
1499962707 gbvrl157.seq
223109306 gbvrl158.seq
1499987716 gbvrl159.seq
1499944030 gbvrl16.seq
361442169 gbvrl160.seq
1499937248 gbvrl161.seq
655384236 gbvrl162.seq
1499962400 gbvrl163.seq
495975290 gbvrl164.seq
1499955444 gbvrl165.seq
498051794 gbvrl166.seq
1499937256 gbvrl167.seq
278911136 gbvrl168.seq
1499958138 gbvrl169.seq
335051659 gbvrl17.seq
261340197 gbvrl170.seq
1499981370 gbvrl171.seq
239707552 gbvrl172.seq
1499968426 gbvrl173.seq
300056763 gbvrl174.seq
1499941598 gbvrl175.seq
223610739 gbvrl176.seq
1499996287 gbvrl177.seq
164216074 gbvrl178.seq
1499987225 gbvrl179.seq
1499998247 gbvrl18.seq
233364533 gbvrl180.seq
1499993209 gbvrl181.seq
459808474 gbvrl182.seq
1499991825 gbvrl183.seq
417550453 gbvrl184.seq
1499993070 gbvrl185.seq
189792762 gbvrl186.seq
1499980672 gbvrl187.seq
243814598 gbvrl188.seq
1499942630 gbvrl189.seq
302408856 gbvrl19.seq
210896000 gbvrl190.seq
1499961934 gbvrl191.seq
406126416 gbvrl192.seq
1499934513 gbvrl193.seq
298752079 gbvrl194.seq
1499985241 gbvrl195.seq
381620147 gbvrl196.seq
1499935983 gbvrl197.seq
622752384 gbvrl198.seq
1499958290 gbvrl199.seq
901266041 gbvrl2.seq
1499991333 gbvrl20.seq
215553455 gbvrl200.seq
1499979010 gbvrl201.seq
1405198296 gbvrl202.seq
1499996146 gbvrl203.seq
283709347 gbvrl204.seq
1499970099 gbvrl205.seq
168039900 gbvrl206.seq
1499934058 gbvrl207.seq
383645627 gbvrl208.seq
1499993564 gbvrl209.seq
358819361 gbvrl21.seq
777883639 gbvrl210.seq
1499989181 gbvrl211.seq
278072833 gbvrl212.seq
1499974111 gbvrl213.seq
343277314 gbvrl214.seq
1499993771 gbvrl215.seq
279422593 gbvrl216.seq
1499997524 gbvrl217.seq
289080379 gbvrl218.seq
1499965512 gbvrl219.seq
1499939558 gbvrl22.seq
457121942 gbvrl220.seq
1499960754 gbvrl221.seq
467815243 gbvrl222.seq
1499960514 gbvrl223.seq
1499985959 gbvrl224.seq
238334442 gbvrl225.seq
1499977222 gbvrl226.seq
765724375 gbvrl227.seq
1499942463 gbvrl228.seq
276311007 gbvrl229.seq
293556959 gbvrl23.seq
1499968884 gbvrl230.seq
191755804 gbvrl231.seq
1499996878 gbvrl232.seq
223768934 gbvrl233.seq
1499998059 gbvrl234.seq
236592953 gbvrl235.seq
1499935820 gbvrl236.seq
835913865 gbvrl237.seq
1499937489 gbvrl238.seq
838380515 gbvrl239.seq
1499948056 gbvrl24.seq
1499989299 gbvrl240.seq
936645239 gbvrl241.seq
1499938825 gbvrl242.seq
314000777 gbvrl243.seq
1499937499 gbvrl244.seq
352317805 gbvrl245.seq
1499996879 gbvrl246.seq
688996500 gbvrl247.seq
1499947636 gbvrl248.seq
230298392 gbvrl249.seq
698157207 gbvrl25.seq
1499947705 gbvrl250.seq
313538698 gbvrl251.seq
1499964038 gbvrl252.seq
222386425 gbvrl253.seq
1499994255 gbvrl254.seq
208464229 gbvrl255.seq
1499958800 gbvrl256.seq
170515596 gbvrl257.seq
1499978974 gbvrl258.seq
205467539 gbvrl259.seq
1499950299 gbvrl26.seq
1499921248 gbvrl260.seq
295924598 gbvrl261.seq
1499933996 gbvrl262.seq
384473267 gbvrl263.seq
1499998178 gbvrl264.seq
201609631 gbvrl265.seq
1499980779 gbvrl266.seq
414414462 gbvrl267.seq
1499969244 gbvrl268.seq
518961077 gbvrl269.seq
686814653 gbvrl27.seq
1499946038 gbvrl270.seq
187827532 gbvrl271.seq
1499999410 gbvrl272.seq
417033938 gbvrl273.seq
1499965806 gbvrl274.seq
587922675 gbvrl275.seq
1499962907 gbvrl276.seq
610979262 gbvrl277.seq
1499982304 gbvrl278.seq
142731307 gbvrl279.seq
1499998085 gbvrl28.seq
1499921043 gbvrl280.seq
236298546 gbvrl281.seq
1499998444 gbvrl282.seq
199036842 gbvrl283.seq
1499993206 gbvrl284.seq
159942571 gbvrl285.seq
1499962746 gbvrl286.seq
217875211 gbvrl287.seq
1499986629 gbvrl288.seq
663803449 gbvrl289.seq
654803222 gbvrl29.seq
492800055 gbvrl290.seq
753935354 gbvrl291.seq
76825365 gbvrl292.seq
1499968382 gbvrl293.seq
252527616 gbvrl294.seq
1499987019 gbvrl295.seq
280831626 gbvrl296.seq
1499997074 gbvrl297.seq
175476247 gbvrl298.seq
1499976226 gbvrl299.seq
1499998879 gbvrl3.seq
1499975560 gbvrl30.seq
148058589 gbvrl300.seq
1499985376 gbvrl301.seq
259854867 gbvrl302.seq
1499990215 gbvrl303.seq
141897533 gbvrl304.seq
1499995644 gbvrl305.seq
120013980 gbvrl306.seq
146315654 gbvrl307.seq
1499993952 gbvrl308.seq
126535326 gbvrl309.seq
411279243 gbvrl31.seq
1499971350 gbvrl310.seq
471575154 gbvrl311.seq
1499987042 gbvrl312.seq
148346202 gbvrl313.seq
1499967337 gbvrl314.seq
363563831 gbvrl315.seq
1499977098 gbvrl316.seq
781877443 gbvrl317.seq
1499987655 gbvrl318.seq
556571433 gbvrl319.seq
1499979055 gbvrl32.seq
1499976345 gbvrl320.seq
404383849 gbvrl321.seq
1499963477 gbvrl322.seq
358758043 gbvrl323.seq
1499966120 gbvrl324.seq
247590173 gbvrl325.seq
1499997788 gbvrl326.seq
314795368 gbvrl327.seq
1499994504 gbvrl328.seq
288183038 gbvrl329.seq
362805534 gbvrl33.seq
1499972760 gbvrl330.seq
285376689 gbvrl331.seq
1499969778 gbvrl332.seq
291838016 gbvrl333.seq
1499983232 gbvrl334.seq
289334857 gbvrl335.seq
1499991956 gbvrl336.seq
280267919 gbvrl337.seq
1499960850 gbvrl338.seq
638243646 gbvrl339.seq
1499935619 gbvrl34.seq
1499972202 gbvrl340.seq
578918054 gbvrl341.seq
1499998481 gbvrl342.seq
599138466 gbvrl343.seq
1499994978 gbvrl344.seq
118761927 gbvrl345.seq
1499999702 gbvrl346.seq
129130663 gbvrl347.seq
1499997643 gbvrl348.seq
129754504 gbvrl349.seq
326771720 gbvrl35.seq
1499987113 gbvrl350.seq
655335361 gbvrl351.seq
1499990003 gbvrl352.seq
260182883 gbvrl353.seq
1499979856 gbvrl354.seq
815755206 gbvrl355.seq
1499985185 gbvrl356.seq
400260625 gbvrl357.seq
1499985087 gbvrl358.seq
1499964474 gbvrl359.seq
1499955243 gbvrl36.seq
128304707 gbvrl360.seq
1499989406 gbvrl361.seq
1478628474 gbvrl362.seq
1499965079 gbvrl363.seq
892375602 gbvrl364.seq
1499976291 gbvrl365.seq
581292052 gbvrl366.seq
1499988415 gbvrl367.seq
1327170446 gbvrl368.seq
1499991156 gbvrl369.seq
45156819 gbvrl37.seq
868341669 gbvrl370.seq
1499965843 gbvrl371.seq
524215476 gbvrl372.seq
1499964968 gbvrl373.seq
522803565 gbvrl374.seq
1499965688 gbvrl375.seq
547042821 gbvrl376.seq
1499981956 gbvrl377.seq
511154172 gbvrl378.seq
1499965124 gbvrl379.seq
1499940966 gbvrl38.seq
243185008 gbvrl380.seq
1499984722 gbvrl381.seq
552412285 gbvrl382.seq
1499961229 gbvrl383.seq
560280642 gbvrl384.seq
1499987446 gbvrl385.seq
191450535 gbvrl386.seq
1499980989 gbvrl387.seq
187245107 gbvrl388.seq
1499992062 gbvrl389.seq
185184481 gbvrl39.seq
194261819 gbvrl390.seq
1499970778 gbvrl391.seq
224025621 gbvrl392.seq
1499984761 gbvrl393.seq
224558133 gbvrl394.seq
1499976504 gbvrl395.seq
192196591 gbvrl396.seq
1499989468 gbvrl397.seq
197533841 gbvrl398.seq
1499963161 gbvrl399.seq
817261417 gbvrl4.seq
1499983088 gbvrl40.seq
1211006043 gbvrl400.seq
1499988072 gbvrl401.seq
373548019 gbvrl402.seq
1499997878 gbvrl403.seq
117986944 gbvrl404.seq
1499997720 gbvrl405.seq
307441580 gbvrl406.seq
1499988566 gbvrl407.seq
1499988609 gbvrl408.seq
79414913 gbvrl409.seq
193686712 gbvrl41.seq
1499981020 gbvrl410.seq
286893252 gbvrl411.seq
1499994169 gbvrl412.seq
690991766 gbvrl413.seq
1499970869 gbvrl414.seq
648355058 gbvrl415.seq
1499972443 gbvrl416.seq
1002053522 gbvrl417.seq
1499998892 gbvrl418.seq
422344526 gbvrl419.seq
1499991523 gbvrl42.seq
1499993517 gbvrl420.seq
199555483 gbvrl421.seq
1499996742 gbvrl422.seq
156641592 gbvrl423.seq
1499982100 gbvrl424.seq
900553679 gbvrl425.seq
1499986807 gbvrl426.seq
845069940 gbvrl427.seq
1499960583 gbvrl428.seq
266973321 gbvrl429.seq
230285954 gbvrl43.seq
1499993266 gbvrl430.seq
155092128 gbvrl431.seq
1499967295 gbvrl432.seq
1499992263 gbvrl433.seq
111811288 gbvrl434.seq
1499996409 gbvrl435.seq
1499998216 gbvrl436.seq
110488005 gbvrl437.seq
1499974697 gbvrl438.seq
1499990602 gbvrl439.seq
1499967735 gbvrl44.seq
166973995 gbvrl440.seq
1499983908 gbvrl441.seq
834156653 gbvrl442.seq
1499993731 gbvrl443.seq
818954404 gbvrl444.seq
1499964915 gbvrl445.seq
981968618 gbvrl446.seq
1499993856 gbvrl447.seq
548472018 gbvrl448.seq
1499968322 gbvrl449.seq
202631912 gbvrl45.seq
154308129 gbvrl450.seq
1499982622 gbvrl451.seq
339429957 gbvrl452.seq
1499976116 gbvrl453.seq
275099037 gbvrl454.seq
1499999775 gbvrl455.seq
433510706 gbvrl456.seq
1499967919 gbvrl457.seq
583697439 gbvrl458.seq
1499986013 gbvrl459.seq
1499954559 gbvrl46.seq
602096993 gbvrl460.seq
1499979751 gbvrl461.seq
369501821 gbvrl462.seq
1499999388 gbvrl463.seq
660264765 gbvrl464.seq
1499992123 gbvrl465.seq
1104098075 gbvrl466.seq
1499984463 gbvrl467.seq
807624966 gbvrl468.seq
1499979791 gbvrl469.seq
252365853 gbvrl47.seq
324543448 gbvrl470.seq
1499979070 gbvrl471.seq
1178264328 gbvrl472.seq
1499966549 gbvrl473.seq
186174121 gbvrl474.seq
1499961445 gbvrl475.seq
936015078 gbvrl476.seq
1499988444 gbvrl477.seq
767653214 gbvrl478.seq
1499966991 gbvrl479.seq
1499967177 gbvrl48.seq
1099967316 gbvrl480.seq
1499989687 gbvrl481.seq
169077838 gbvrl482.seq
1499984643 gbvrl483.seq
167845153 gbvrl484.seq
1499994449 gbvrl485.seq
1499957168 gbvrl486.seq
148254697 gbvrl487.seq
1499944393 gbvrl488.seq
398328015 gbvrl489.seq
447617213 gbvrl49.seq
1499946143 gbvrl490.seq
272092543 gbvrl491.seq
1499943173 gbvrl492.seq
155362728 gbvrl493.seq
1499979079 gbvrl494.seq
162959218 gbvrl495.seq
1499974422 gbvrl496.seq
161703645 gbvrl497.seq
1499982090 gbvrl498.seq
176544819 gbvrl499.seq
1499997719 gbvrl5.seq
1499974383 gbvrl50.seq
1499953215 gbvrl500.seq
751134244 gbvrl501.seq
1499958162 gbvrl502.seq
1499964219 gbvrl503.seq
215692345 gbvrl504.seq
147269138 gbvrl51.seq
1499983714 gbvrl52.seq
511776269 gbvrl53.seq
1499973777 gbvrl54.seq
261163675 gbvrl55.seq
1499944892 gbvrl56.seq
510777902 gbvrl57.seq
1499995215 gbvrl58.seq
817415523 gbvrl59.seq
169207272 gbvrl6.seq
1499980013 gbvrl60.seq
1230490022 gbvrl61.seq
1499971382 gbvrl62.seq
325763725 gbvrl63.seq
1499980028 gbvrl64.seq
301367589 gbvrl65.seq
1499969226 gbvrl66.seq
188123844 gbvrl67.seq
1499962090 gbvrl68.seq
763759272 gbvrl69.seq
1138295339 gbvrl7.seq
1499988781 gbvrl70.seq
240167140 gbvrl71.seq
1499958010 gbvrl72.seq
768489646 gbvrl73.seq
1499966296 gbvrl74.seq
730324025 gbvrl75.seq
1499947675 gbvrl76.seq
338621320 gbvrl77.seq
1499983052 gbvrl78.seq
135739427 gbvrl79.seq
1322763033 gbvrl8.seq
1499963616 gbvrl80.seq
154500299 gbvrl81.seq
1499961249 gbvrl82.seq
493282962 gbvrl83.seq
1499939028 gbvrl84.seq
507522902 gbvrl85.seq
1500000150 gbvrl86.seq
177157762 gbvrl87.seq
1499983292 gbvrl88.seq
768363199 gbvrl89.seq
1350043310 gbvrl9.seq
1499983381 gbvrl90.seq
782881658 gbvrl91.seq
1499990178 gbvrl92.seq
813541907 gbvrl93.seq
1499993416 gbvrl94.seq
786967571 gbvrl95.seq
1499941055 gbvrl96.seq
771088207 gbvrl97.seq
1499991875 gbvrl98.seq
784500075 gbvrl99.seq
1468251866 gbvrt1.seq
36035214 gbvrt10.seq
1496966169 gbvrt100.seq
241197914 gbvrt101.seq
1485729464 gbvrt102.seq
364224646 gbvrt103.seq
1454173384 gbvrt104.seq
502254939 gbvrt105.seq
1486134171 gbvrt106.seq
517506322 gbvrt107.seq
1480727556 gbvrt108.seq
529300923 gbvrt109.seq
18509260 gbvrt11.seq
1459332513 gbvrt110.seq
519249086 gbvrt111.seq
1412269603 gbvrt112.seq
909200691 gbvrt113.seq
1459032465 gbvrt114.seq
536522478 gbvrt115.seq
1495454402 gbvrt116.seq
1299521930 gbvrt117.seq
1068402516 gbvrt118.seq
1067356333 gbvrt119.seq
1476200942 gbvrt12.seq
896844819 gbvrt120.seq
805318347 gbvrt121.seq
1275607078 gbvrt122.seq
1208361644 gbvrt123.seq
874873715 gbvrt124.seq
1313422787 gbvrt125.seq
610271897 gbvrt126.seq
1339215836 gbvrt127.seq
979774829 gbvrt128.seq
1497239942 gbvrt129.seq
400795564 gbvrt13.seq
618699677 gbvrt130.seq
1499998846 gbvrt131.seq
31773369 gbvrt132.seq
1499989895 gbvrt133.seq
332826556 gbvrt134.seq
1482267392 gbvrt135.seq
261184260 gbvrt136.seq
1499143791 gbvrt137.seq
307973844 gbvrt138.seq
1496470535 gbvrt139.seq
1477671221 gbvrt14.seq
318409993 gbvrt140.seq
1387287611 gbvrt141.seq
440417012 gbvrt142.seq
1462502954 gbvrt143.seq
397305085 gbvrt144.seq
1452249458 gbvrt145.seq
304334214 gbvrt146.seq
1499844770 gbvrt147.seq
379445084 gbvrt148.seq
1455454267 gbvrt149.seq
1470893574 gbvrt15.seq
638926262 gbvrt150.seq
1347300249 gbvrt151.seq
1090722360 gbvrt152.seq
1424049174 gbvrt153.seq
1131671891 gbvrt154.seq
1475422119 gbvrt155.seq
669038893 gbvrt156.seq
1423634438 gbvrt157.seq
610507108 gbvrt158.seq
1499738673 gbvrt159.seq
31730937 gbvrt16.seq
396058162 gbvrt160.seq
1465167303 gbvrt161.seq
1318097988 gbvrt162.seq
1411652468 gbvrt163.seq
830773125 gbvrt164.seq
1475965973 gbvrt165.seq
455698121 gbvrt166.seq
1323021610 gbvrt167.seq
551278929 gbvrt168.seq
1434907616 gbvrt169.seq
1452402811 gbvrt17.seq
935652816 gbvrt170.seq
1471350912 gbvrt171.seq
428120730 gbvrt172.seq
1491982996 gbvrt173.seq
399691693 gbvrt174.seq
1435928990 gbvrt175.seq
1247981644 gbvrt176.seq
1387198418 gbvrt177.seq
213511451 gbvrt178.seq
1489746530 gbvrt179.seq
1092242590 gbvrt18.seq
759478599 gbvrt180.seq
1468623321 gbvrt181.seq
460358961 gbvrt182.seq
1467172079 gbvrt183.seq
1345676885 gbvrt184.seq
1486880208 gbvrt185.seq
1122413695 gbvrt186.seq
1476213975 gbvrt187.seq
397154674 gbvrt188.seq
1467952250 gbvrt189.seq
1316531590 gbvrt19.seq
389233192 gbvrt190.seq
1426124383 gbvrt191.seq
405994817 gbvrt192.seq
1469721309 gbvrt193.seq
383609506 gbvrt194.seq
1381550136 gbvrt195.seq
561205545 gbvrt196.seq
1492012864 gbvrt197.seq
653049694 gbvrt198.seq
1450733360 gbvrt199.seq
179100385 gbvrt2.seq
499274320 gbvrt20.seq
1067207425 gbvrt200.seq
1459744678 gbvrt201.seq
364192132 gbvrt202.seq
1486440147 gbvrt203.seq
653832483 gbvrt204.seq
1493363852 gbvrt205.seq
916878857 gbvrt206.seq
1460465244 gbvrt207.seq
684468901 gbvrt208.seq
1448879046 gbvrt209.seq
1481126296 gbvrt21.seq
1487906747 gbvrt210.seq
434375389 gbvrt211.seq
1488706305 gbvrt212.seq
1478032480 gbvrt213.seq
278515425 gbvrt214.seq
1469979030 gbvrt215.seq
961949486 gbvrt216.seq
1483460944 gbvrt217.seq
677455821 gbvrt218.seq
1483117142 gbvrt219.seq
940986949 gbvrt22.seq
717892540 gbvrt220.seq
1437009150 gbvrt221.seq
957295578 gbvrt222.seq
1476461444 gbvrt223.seq
272371816 gbvrt224.seq
1485679392 gbvrt225.seq
1256408466 gbvrt226.seq
614199771 gbvrt227.seq
1395355507 gbvrt228.seq
696592317 gbvrt229.seq
1487830536 gbvrt23.seq
1290299260 gbvrt230.seq
277305753 gbvrt231.seq
1490467815 gbvrt232.seq
655125810 gbvrt233.seq
1446091140 gbvrt234.seq
932987741 gbvrt235.seq
1479165935 gbvrt236.seq
363696484 gbvrt237.seq
1492170807 gbvrt238.seq
923218703 gbvrt239.seq
450447428 gbvrt24.seq
1483460647 gbvrt240.seq
229681606 gbvrt241.seq
1492440981 gbvrt242.seq
1284017470 gbvrt243.seq
1394001431 gbvrt244.seq
673363046 gbvrt245.seq
1488473559 gbvrt246.seq
407893020 gbvrt247.seq
1473520932 gbvrt248.seq
654301981 gbvrt249.seq
1472193104 gbvrt25.seq
1469440727 gbvrt250.seq
934642922 gbvrt251.seq
1460398956 gbvrt252.seq
1493793319 gbvrt253.seq
374388369 gbvrt254.seq
1484677935 gbvrt255.seq
1009171480 gbvrt256.seq
1403476973 gbvrt257.seq
1346978043 gbvrt258.seq
1441967866 gbvrt259.seq
527707663 gbvrt26.seq
1400240904 gbvrt260.seq
1431872514 gbvrt261.seq
1313624297 gbvrt262.seq
1468694106 gbvrt263.seq
1150332037 gbvrt264.seq
1451298392 gbvrt265.seq
1246209539 gbvrt266.seq
1470502273 gbvrt267.seq
1336897357 gbvrt268.seq
319998963 gbvrt269.seq
14152653 gbvrt27.seq
1475568727 gbvrt270.seq
1415490397 gbvrt271.seq
253027138 gbvrt272.seq
1432307200 gbvrt273.seq
1311976620 gbvrt274.seq
1460425638 gbvrt275.seq
1476888336 gbvrt276.seq
29336916 gbvrt277.seq
1440551986 gbvrt278.seq
1454909597 gbvrt279.seq
21384662 gbvrt28.seq
1491973531 gbvrt280.seq
1462769312 gbvrt281.seq
46163794 gbvrt282.seq
1483538934 gbvrt283.seq
1187283614 gbvrt284.seq
1486282210 gbvrt285.seq
1462805977 gbvrt286.seq
59762000 gbvrt287.seq
1452509940 gbvrt288.seq
1289334495 gbvrt289.seq
90973101 gbvrt29.seq
1456799043 gbvrt290.seq
1487682484 gbvrt291.seq
77670827 gbvrt292.seq
1495798542 gbvrt293.seq
615745736 gbvrt294.seq
1440331708 gbvrt295.seq
684814957 gbvrt296.seq
1750969594 gbvrt297.seq
1582584122 gbvrt298.seq
1439178988 gbvrt299.seq
1480634500 gbvrt3.seq
1499998829 gbvrt30.seq
1385914538 gbvrt300.seq
1260623871 gbvrt301.seq
1241027078 gbvrt302.seq
1090782000 gbvrt303.seq
951059003 gbvrt304.seq
1800655812 gbvrt305.seq
1625880297 gbvrt306.seq
1452341451 gbvrt307.seq
1413268707 gbvrt308.seq
1301679404 gbvrt309.seq
56992953 gbvrt31.seq
1265017882 gbvrt310.seq
1398329117 gbvrt311.seq
232572764 gbvrt312.seq
413741212 gbvrt313.seq
2486764648 gbvrt314.seq
2399841711 gbvrt315.seq
2168065652 gbvrt316.seq
1730481357 gbvrt317.seq
1674077467 gbvrt318.seq
1643880041 gbvrt319.seq
1460461988 gbvrt32.seq
1613167793 gbvrt320.seq
1585967368 gbvrt321.seq
1573317635 gbvrt322.seq
1525189779 gbvrt323.seq
1522308102 gbvrt324.seq
1503557506 gbvrt325.seq
1502833827 gbvrt326.seq
1439581620 gbvrt327.seq
1297818631 gbvrt328.seq
1258324368 gbvrt329.seq
572961549 gbvrt33.seq
1369247334 gbvrt330.seq
1105990709 gbvrt331.seq
1461508990 gbvrt332.seq
637930593 gbvrt333.seq
1491748048 gbvrt334.seq
581838617 gbvrt335.seq
622026375 gbvrt34.seq
949235536 gbvrt35.seq
529710053 gbvrt36.seq
444775759 gbvrt37.seq
889595702 gbvrt38.seq
780146170 gbvrt39.seq
1457523660 gbvrt4.seq
1488152746 gbvrt40.seq
1479243859 gbvrt41.seq
202128841 gbvrt42.seq
123737443 gbvrt43.seq
1498565199 gbvrt44.seq
763182343 gbvrt45.seq
1488185729 gbvrt46.seq
819078271 gbvrt47.seq
1499445183 gbvrt48.seq
296243230 gbvrt49.seq
263992100 gbvrt5.seq
1143508697 gbvrt50.seq
1296370380 gbvrt51.seq
746782204 gbvrt52.seq
1457234622 gbvrt53.seq
393840973 gbvrt54.seq
1494590474 gbvrt55.seq
435867530 gbvrt56.seq
1485692216 gbvrt57.seq
404627914 gbvrt58.seq
1063697372 gbvrt59.seq
290137511 gbvrt6.seq
1045817455 gbvrt60.seq
1371630420 gbvrt61.seq
960934801 gbvrt62.seq
1493316628 gbvrt63.seq
1475293258 gbvrt64.seq
58362561 gbvrt65.seq
1482158915 gbvrt66.seq
639394801 gbvrt67.seq
1498842847 gbvrt68.seq
33970348 gbvrt69.seq
87351605 gbvrt7.seq
979125220 gbvrt70.seq
838606763 gbvrt71.seq
1154852032 gbvrt72.seq
461393140 gbvrt73.seq
1435965547 gbvrt74.seq
1109806300 gbvrt75.seq
1468553589 gbvrt76.seq
102870006 gbvrt77.seq
1493447786 gbvrt78.seq
82391381 gbvrt79.seq
784474650 gbvrt8.seq
1481005359 gbvrt80.seq
135038714 gbvrt81.seq
957165421 gbvrt82.seq
366785399 gbvrt83.seq
1174207210 gbvrt84.seq
1368170987 gbvrt85.seq
1282827292 gbvrt86.seq
580591240 gbvrt87.seq
1496410569 gbvrt88.seq
1024127150 gbvrt89.seq
15637436 gbvrt9.seq
1427163403 gbvrt90.seq
309141780 gbvrt91.seq
1177172531 gbvrt92.seq
397267012 gbvrt93.seq
1323824839 gbvrt94.seq
807815425 gbvrt95.seq
1330262106 gbvrt96.seq
539530879 gbvrt97.seq
1447265202 gbvrt98.seq
467059616 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 139664 536999711
BCT10 390 694003146
BCT100 293 679294620
BCT101 313 686008328
BCT102 86 186554933
BCT103 315 673356486
BCT104 71 266229652
BCT105 359 707464119
BCT106 185 331548218
BCT107 540 723201010
BCT108 49 79557253
BCT109 259 685328142
BCT11 247 282188724
BCT110 144 305110474
BCT111 268 670236543
BCT112 114 281252692
BCT113 329 738947741
BCT114 158 230327834
BCT115 283 703675834
BCT116 77 201962351
BCT117 305 767929105
BCT118 319 584205223
BCT119 296 766696863
BCT12 384 664743830
BCT120 59 208789717
BCT121 334 692270779
BCT122 91 253364550
BCT123 288 651858869
BCT124 370 693488277
BCT125 157 354462091
BCT126 284 672223242
BCT127 97 183022758
BCT128 266 694640215
BCT129 105 213496548
BCT13 317 485922249
BCT130 446 656193558
BCT131 163 250866080
BCT132 377 706151574
BCT133 126 282249302
BCT134 327 670812957
BCT135 424 659426410
BCT136 113 172260629
BCT137 320 674859435
BCT138 189 404428216
BCT139 281 697681585
BCT14 276 687623374
BCT140 140 403171025
BCT141 369 669036164
BCT142 243 448139257
BCT143 316 699744804
BCT144 150 407349061
BCT145 478 699871534
BCT146 288 497943859
BCT147 477 746353925
BCT148 150 337823520
BCT149 959 699342382
BCT15 166 297846171
BCT150 480 455342118
BCT151 338 656362787
BCT152 545 674775711
BCT153 203 383021913
BCT154 429 667148863
BCT155 370 704497346
BCT156 57 119601929
BCT157 390 687378593
BCT158 239 472807144
BCT159 329 685145659
BCT16 285 686055421
BCT160 199 664697068
BCT161 179 240675893
BCT162 441 712261572
BCT163 289 330907991
BCT164 251 706064284
BCT165 71 284878415
BCT166 315 670872955
BCT167 428 701304051
BCT168 173 335960774
BCT169 667 730615224
BCT17 309 503821199
BCT170 396 712058429
BCT171 119 241943416
BCT172 291 674466192
BCT173 332 587815415
BCT174 319 670045139
BCT175 367 846250492
BCT176 61 146044509
BCT177 370 670602954
BCT178 369 678296218
BCT179 201 316231094
BCT18 435 753272469
BCT180 424 675491536
BCT181 311 490137761
BCT182 415 679490372
BCT183 192 437447487
BCT184 330 787716437
BCT185 187 349442111
BCT186 341 657768625
BCT187 168 445532656
BCT188 342 666061591
BCT189 163 298189685
BCT19 159 292768654
BCT190 406 689598288
BCT191 169 218145337
BCT192 472 652378164
BCT193 312 665745608
BCT194 361 692387575
BCT195 249 666682460
BCT196 80 144086040
BCT197 400 666252680
BCT198 143 254983835
BCT199 376 661814324
BCT2 41290 139250707
BCT20 598 677730064
BCT200 315 201951674
BCT201 628 644873273
BCT202 481 651195160
BCT203 70 94940965
BCT204 439 636051606
BCT205 418 612731900
BCT206 437 637962908
BCT207 220 328677699
BCT208 500 698086729
BCT209 127 251573754
BCT21 140 193439584
BCT210 372 682660814
BCT211 227 341377866
BCT212 316 688661747
BCT213 299 752239048
BCT214 68 130665359
BCT215 441 675656916
BCT216 434 667598041
BCT217 144 227879512
BCT218 334 695180798
BCT219 193 289978125
BCT22 462 674392358
BCT220 338 660371791
BCT221 260 306897426
BCT222 426 827844024
BCT223 386 727585125
BCT224 142 309990352
BCT225 304 678101365
BCT226 372 654818872
BCT227 54 66684327
BCT228 386 664990523
BCT229 477 532214026
BCT23 342 372212662
BCT230 321 686558904
BCT231 483 644375735
BCT232 75 90645632
BCT233 413 677931216
BCT234 254 367362629
BCT235 440 693114727
BCT236 350 646825420
BCT237 485 707552806
BCT238 249 529154963
BCT239 415 688842497
BCT24 357 677414549
BCT240 210 471765803
BCT241 358 671094502
BCT242 319 675028021
BCT243 46 122532076
BCT244 440 668226425
BCT245 381 644602548
BCT246 504 684756018
BCT247 335 667187177
BCT248 166 193072369
BCT249 237 644271788
BCT25 163 327723212
BCT250 308 591708499
BCT251 345 672014255
BCT252 258 420886518
BCT253 214 658347488
BCT254 232 376629222
BCT255 300 659307445
BCT256 145 221302631
BCT257 307 653479585
BCT258 180 260037147
BCT259 345 686074346
BCT26 342 677867422
BCT260 173 296775957
BCT261 377 666927692
BCT262 264 782239457
BCT263 365 747173659
BCT264 247 418943060
BCT265 437 651796745
BCT266 374 616528903
BCT267 309 667222417
BCT268 182 302230052
BCT269 438 679546578
BCT27 539 365754832
BCT270 424 460180827
BCT271 387 699745129
BCT272 325 501491124
BCT273 416 644538422
BCT274 193 253356878
BCT275 386 691663821
BCT276 263 402417581
BCT277 443 694583877
BCT278 260 466472220
BCT279 459 693247317
BCT28 5200 7533877
BCT280 213 639323632
BCT281 292 654469081
BCT282 171 432101955
BCT283 651 649602723
BCT284 318 698634113
BCT285 175 280721442
BCT286 274 661920829
BCT287 315 489899014
BCT288 396 646216098
BCT289 176 390471586
BCT29 10402 13141863
BCT290 293 688048690
BCT291 369 671728286
BCT292 100 168361190
BCT293 333 667080044
BCT294 193 338774227
BCT295 303 664019838
BCT296 231 324037067
BCT297 344 647185266
BCT298 405 677626684
BCT299 59 98012374
BCT3 20642 162919204
BCT30 54209 648763156
BCT300 235 643472315
BCT301 353 629473515
BCT302 292 640635194
BCT303 224 327193062
BCT304 405 646629552
BCT305 209 334314959
BCT306 455 670886315
BCT307 480 689830044
BCT308 79 136453141
BCT309 281 633821805
BCT31 121 222525681
BCT310 360 654202900
BCT311 147 285619086
BCT312 361 665544683
BCT313 378 627905296
BCT314 383 627347667
BCT315 266 468400974
BCT316 323 644856870
BCT317 457 685778213
BCT318 370 654708580
BCT319 164 204896696
BCT32 358 671327540
BCT320 424 685424526
BCT321 137 216476595
BCT322 330 650007272
BCT323 105 284506479
BCT324 440 656174607
BCT325 94 265503770
BCT326 340 672439014
BCT327 206 275447558
BCT328 335 641963483
BCT329 249 499515028
BCT33 419 594405189
BCT330 377 628733950
BCT331 215 415878255
BCT332 312 678427785
BCT333 487 756142949
BCT334 7 12175701
BCT335 167 636678640
BCT336 97 631099143
BCT337 127 646036009
BCT338 57 345887642
BCT339 143 645379470
BCT34 456 674092197
BCT340 78 433650689
BCT341 160 653226107
BCT342 115 443663645
BCT343 152 648947181
BCT344 55 241628868
BCT345 121 646195308
BCT346 47 253146779
BCT347 147 647737870
BCT348 120 584084839
BCT349 134 643229316
BCT35 372 603078315
BCT350 233 540284271
BCT351 360 706638515
BCT352 189 407732583
BCT353 358 635267831
BCT354 353 525187528
BCT355 316 665260954
BCT356 227 530966011
BCT357 508 682664960
BCT358 97 276195473
BCT359 222 628005525
BCT36 379 664089429
BCT360 135 261140776
BCT361 448 671452315
BCT362 304 451894328
BCT363 473 640454650
BCT364 282 630968580
BCT365 44 49365259
BCT366 374 686399450
BCT367 279 614360383
BCT368 410 696019501
BCT369 336 549373091
BCT37 367 677624510
BCT370 452 676362373
BCT371 125 232240613
BCT372 292 654884521
BCT373 110 239102413
BCT374 386 670241512
BCT375 198 396321805
BCT376 542 677607842
BCT377 529 668233061
BCT378 205 325587904
BCT379 533 628729971
BCT38 39 56943508
BCT380 292 612777106
BCT381 441 627143876
BCT382 282 641856257
BCT383 45 135416463
BCT384 267 641191647
BCT385 380 630093546
BCT386 54 132349865
BCT387 363 628726174
BCT388 295 478775852
BCT389 262 647060936
BCT39 374 694325818
BCT390 193 278775216
BCT391 391 632570770
BCT392 273 401376675
BCT393 360 714288715
BCT394 179 585563825
BCT395 715 837158731
BCT396 428 662068161
BCT397 150 217893989
BCT398 317 653922060
BCT399 196 389387844
BCT4 2600 37759883
BCT40 396 693357627
BCT400 262 626371585
BCT401 415 635052135
BCT402 416 654428093
BCT403 228 352865964
BCT404 332 692695031
BCT405 254 520439330
BCT406 354 668544598
BCT407 192 293077675
BCT408 271 641523889
BCT409 396 511625065
BCT41 52 118148953
BCT410 368 656089854
BCT411 275 527755967
BCT412 362 627017345
BCT413 348 613746112
BCT414 358 654142212
BCT415 255 407111800
BCT416 199 647576609
BCT417 221 618010489
BCT418 323 403184809
BCT419 380 651461568
BCT42 796 696617075
BCT420 201 384658950
BCT421 430 621946295
BCT422 384 672461276
BCT423 53 112960313
BCT424 430 640503548
BCT425 353 681466803
BCT426 104 266552429
BCT427 448 610606863
BCT428 273 304930363
BCT429 354 625049936
BCT43 230 431440059
BCT430 335 633780128
BCT431 22 47513250
BCT432 272 628774829
BCT433 48 280861669
BCT434 186 655293758
BCT435 152 314183594
BCT436 437 647528618
BCT437 179 339514769
BCT438 195 622433834
BCT439 122 312326935
BCT44 311 684059725
BCT440 344 618974154
BCT441 137 290483940
BCT442 406 634048533
BCT443 381 637412213
BCT444 3 4917111
BCT445 311 673601142
BCT446 375 614034697
BCT447 23 60332532
BCT448 334 639179916
BCT449 495 654385553
BCT45 154 357666507
BCT450 27 63175162
BCT451 362 627367507
BCT452 254 296647566
BCT453 317 633459448
BCT454 371 576319407
BCT455 528 115589384
BCT456 1589 2511957
BCT457 3172 5268484
BCT458 6338 7796395
BCT459 12613 14997690
BCT46 144 637189325
BCT460 25523 27672494
BCT461 50566 54072851
BCT462 166383 556300215
BCT463 12332 675554497
BCT464 37482 37185396
BCT465 92237 583946925
BCT466 161671 250146338
BCT467 233739 245045545
BCT468 170494 176667674
BCT469 164080 211250280
BCT47 160 545984007
BCT470 124079 195539297
BCT471 33016 54145060
BCT472 51412 601778683
BCT473 10328 728421317
BCT474 230 653821350
BCT475 33 131631016
BCT476 1323 754705553
BCT477 315 83741870
BCT478 2127 810456341
BCT479 1183 371759925
BCT48 340 704704839
BCT480 4193 886697155
BCT481 334 232684475
BCT482 1043 1030649457
BCT483 1955 264372364
BCT484 3187 696028611
BCT485 1230 124242115
BCT486 1505 751257121
BCT487 3124 318518660
BCT488 2788 828576046
BCT489 3023 263078339
BCT49 146 405372370
BCT490 11940 19905115
BCT491 25214 42009480
BCT492 325442 547533671
BCT493 271396 689170900
BCT494 230558 624089160
BCT495 722 688004891
BCT496 577 618768312
BCT497 38 55093914
BCT498 607 618099506
BCT499 210 257204804
BCT5 1310 133308362
BCT50 259 690725478
BCT500 795 654371392
BCT501 887 213393379
BCT502 1341 819372934
BCT503 286 280175806
BCT504 34593 1071632623
BCT505 59870 100386217
BCT51 63 136095527
BCT52 279 702765807
BCT53 26 40531428
BCT54 343 697338437
BCT55 58 110998566
BCT56 301 660722517
BCT57 127 223764756
BCT58 453 673424782
BCT59 101 303664097
BCT6 430 725555801
BCT60 242 671563340
BCT61 82 227377851
BCT62 268 664367513
BCT63 56 148271596
BCT64 291 670664321
BCT65 86 227081335
BCT66 323 663992349
BCT67 333 679448001
BCT68 86 182409315
BCT69 369 662183874
BCT7 316 516242823
BCT70 84 205444414
BCT71 294 658701110
BCT72 233 500919777
BCT73 422 664297264
BCT74 223 395380526
BCT75 370 666003289
BCT76 348 636504855
BCT77 296 676281588
BCT78 342 666097565
BCT79 38 75313317
BCT8 514 732280603
BCT80 358 673377884
BCT81 94 214484227
BCT82 351 683940273
BCT83 87 223229033
BCT84 336 686119856
BCT85 103 304051498
BCT86 343 675434425
BCT87 80 115502557
BCT88 379 669168323
BCT89 88 131589933
BCT9 245 283828224
BCT90 353 663579784
BCT91 96 256891944
BCT92 356 677675082
BCT93 266 577177478
BCT94 333 670989602
BCT95 180 339695403
BCT96 366 714952072
BCT97 228 331655967
BCT98 327 660101032
BCT99 207 439418004
ENV1 404940 509857425
ENV10 183069 146780243
ENV11 492910 245408708
ENV12 680880 353489669
ENV13 27926 26142526
ENV14 421694 313470755
ENV15 519063 426099006
ENV16 11751 16006918
ENV17 476491 288515159
ENV18 375200 290695381
ENV19 517433 393056635
ENV2 73 11613513
ENV20 508906 314719962
ENV21 472263 319401570
ENV22 525525 295738808
ENV23 537294 220329109
ENV24 592004 283001775
ENV25 563263 321661152
ENV26 57911 45473895
ENV27 587633 414962385
ENV28 97969 45181922
ENV29 393209 417752053
ENV3 319 731777883
ENV30 260218 550524979
ENV31 255710 729419683
ENV32 5034 384689370
ENV33 2493 1169950313
ENV34 1068 442962284
ENV35 1934 1180770225
ENV36 1128 437186186
ENV37 1768 1180613371
ENV38 626 218764501
ENV39 21828 1112828581
ENV4 89 278074983
ENV40 20731 140489947
ENV5 284 677335420
ENV6 33304 642286644
ENV7 206208 161456664
ENV8 414918 279534879
ENV9 599239 400796258
EST1 465976 174308005
EST10 481577 252082320
EST100 158147 88094699
EST101 493158 275046361
EST102 154890 85087468
EST103 547240 296212967
EST104 168391 100328981
EST105 555688 328690743
EST106 185766 121524244
EST107 580225 336391510
EST108 545191 308142191
EST109 130519 94474032
EST11 429846 128219717
EST110 508847 301359710
EST111 109064 112379265
EST112 437519 290655756
EST113 220947 102208395
EST114 398619 285015700
EST115 130889 92543090
EST116 389716 266775573
EST117 36548 26163923
EST118 382022 252074412
EST119 161584 125955519
EST12 221166 94065114
EST120 420127 313703077
EST121 184959 116563966
EST122 462576 311253650
EST123 140052 105645356
EST124 534829 299246456
EST125 170991 73030272
EST126 571281 236570929
EST127 491947 310854033
EST128 151633 111328460
EST129 528273 304797308
EST13 574066 276156375
EST130 161309 106027562
EST131 677540 334207567
EST132 151098 28711854
EST133 559655 299741791
EST134 160224 95384731
EST135 490023 306480012
EST136 576986 193259968
EST137 189300 104781415
EST138 510389 321439304
EST139 165977 109750407
EST14 149633 63781453
EST140 414680 231841731
EST141 169165 109609805
EST142 657323 144220515
EST143 152251 98608210
EST144 534506 235415684
EST145 189664 85842442
EST146 332806 200909185
EST147 491183 305564747
EST148 155779 102526376
EST149 522652 307924554
EST15 474568 200967207
EST150 179271 59947652
EST151 587308 221970686
EST152 134728 70211808
EST153 473592 299055057
EST154 127497 99641733
EST155 459728 278586225
EST156 180967 110916687
EST157 45656 24624838
EST158 451349 303422064
EST159 183084 135580474
EST16 160962 66043368
EST160 464404 312897214
EST161 189399 130155794
EST162 407887 274749429
EST163 198569 138310610
EST164 452689 254020495
EST165 144187 103733981
EST166 425865 264732058
EST167 20623 12736308
EST168 426733 236813999
EST169 143919 94566705
EST17 306608 95571642
EST170 397887 240258987
EST171 241073 95460589
EST172 486689 279364963
EST173 138149 89269660
EST174 445456 288763289
EST175 182155 105268865
EST176 422937 273024480
EST177 103805 57906829
EST178 219943 129375172
EST179 435862 117125271
EST18 138052 41387053
EST180 190950 95121038
EST181 659096 332056302
EST182 127130 74522588
EST183 352989 223093653
EST184 493815 223270384
EST185 567683 329791022
EST186 442902 240433889
EST187 451830 310350657
EST188 381549 264729283
EST189 387238 232559712
EST19 299436 115813634
EST190 431548 239746327
EST191 424495 267800387
EST192 606518 384619438
EST193 189550 147652903
EST194 557182 367467313
EST195 188651 95531952
EST196 53496 4381716
EST197 451133 55157858
EST198 156807 31263509
EST199 460368 211332012
EST2 142972 56362966
EST20 176929 85502574
EST200 181353 124806902
EST201 445100 290099564
EST202 158052 106518489
EST203 465727 306467960
EST204 177793 52828754
EST205 457921 239013622
EST206 192739 124166988
EST207 471668 292758584
EST208 53582 36368102
EST209 419056 265466533
EST21 496953 246041138
EST210 200883 108404595
EST211 475990 286007102
EST212 152337 94448802
EST213 276286 196489423
EST214 180678 101734904
EST215 389182 240021351
EST216 198580 118458430
EST217 460272 275108764
EST218 184431 97105849
EST219 52576 18674859
EST22 154884 80583125
EST220 357770 195914248
EST221 403737 237446972
EST222 440714 284713365
EST223 154782 104219075
EST224 556630 237259583
EST225 198957 81989254
EST226 533110 305456743
EST227 172256 103855394
EST228 561891 312395524
EST229 148174 94369130
EST23 264609 135994557
EST230 601018 359923809
EST231 242717 139214337
EST232 508900 312904166
EST233 142528 105405842
EST234 476833 262183573
EST235 163063 89048145
EST236 499874 289251350
EST237 179145 110564956
EST238 483704 314410532
EST239 394518 234369124
EST24 460255 266090206
EST240 499671 220317300
EST241 576113 283373013
EST242 254793 94532453
EST25 150080 70014017
EST26 455011 225701932
EST27 144645 70152894
EST28 460790 281786911
EST29 160349 95681093
EST3 492128 195350244
EST30 484281 271248323
EST31 142362 77843130
EST32 445680 260773408
EST33 153930 89411770
EST34 29919 18235506
EST35 569207 308975013
EST36 182138 105124998
EST37 500240 278239048
EST38 139318 68371833
EST39 435032 255802560
EST4 161030 67846589
EST40 154829 96917255
EST41 589948 319695737
EST42 192079 90439638
EST43 487449 258618294
EST44 158966 76793640
EST45 9280 6073374
EST46 442740 260797798
EST47 156608 97638774
EST48 421050 306171448
EST49 138671 96437559
EST5 488670 205648899
EST50 507076 302237470
EST51 243576 145748051
EST52 601118 323929605
EST53 5247 4072427
EST54 469569 317285388
EST55 22061 15459633
EST56 250340 125936906
EST57 202081 76928243
EST58 250503 102943876
EST59 98585 38868261
EST6 150867 64812883
EST60 427303 216191888
EST61 175185 110572580
EST62 446633 263401687
EST63 190475 97972920
EST64 441394 236168582
EST65 167680 90621192
EST66 527228 302718004
EST67 102270 51115202
EST68 432405 247335621
EST69 175123 90970490
EST7 291441 131311477
EST70 543445 284379853
EST71 164437 89153404
EST72 420371 254352072
EST73 167158 91218871
EST74 355879 177143441
EST75 150529 60061844
EST76 413719 180471295
EST77 196862 91090078
EST78 311172 203722989
EST79 526471 312854441
EST8 501115 299793017
EST80 145000 99007544
EST81 433454 246078132
EST82 174304 99117738
EST83 477981 282254939
EST84 145595 81335937
EST85 459826 254706957
EST86 155865 96752738
EST87 450577 259786399
EST88 178269 102933774
EST89 5847 2580354
EST9 439351 285544455
EST90 369514 213693507
EST91 415229 292637772
EST92 419069 250971251
EST93 375416 191054939
EST94 436841 262951080
EST95 165132 96827654
EST96 439190 281516638
EST97 153002 94469004
EST98 301149 203641357
EST99 490736 268040945
GSS1 483479 349296758
GSS10 391683 194341709
GSS100 2274 1542283
GSS101 776374 133025642
GSS102 122799 38229406
GSS103 624800 195033669
GSS104 154284 118424343
GSS105 496563 436607634
GSS106 175118 110480586
GSS107 665326 198163607
GSS108 119552 74878565
GSS109 462006 285653804
GSS11 155367 79661762
GSS110 166240 155187647
GSS111 112668 95722541
GSS112 555202 399341861
GSS113 188219 120281085
GSS114 482468 298773687
GSS115 217825 157511758
GSS116 543320 316118332
GSS117 207632 160972255
GSS118 590057 423851163
GSS119 850 586793
GSS12 457194 238007113
GSS120 616159 297779103
GSS121 177796 157191723
GSS122 638931 402352079
GSS13 175146 90549850
GSS14 537019 298986355
GSS15 173003 102201943
GSS16 513089 314581178
GSS17 177549 111653998
GSS18 418012 267632244
GSS19 521878 393366768
GSS2 152811 121962910
GSS20 139779 92576848
GSS21 568748 363446849
GSS22 185751 99552297
GSS23 620985 349129033
GSS24 158242 124831479
GSS25 554037 298920380
GSS26 157764 106194423
GSS27 23373 13575160
GSS28 505039 370708561
GSS29 172261 112292009
GSS3 500645 345234463
GSS30 565432 375242318
GSS31 188393 112242104
GSS32 605466 430616003
GSS33 173702 107612445
GSS34 501724 284079029
GSS35 10996 7014618
GSS36 491030 309073818
GSS37 170755 109403665
GSS38 537890 353275776
GSS39 166231 108123239
GSS4 157004 133272678
GSS40 536737 340172826
GSS41 202632 111594409
GSS42 653734 335593144
GSS43 183488 92579192
GSS44 94686 37020965
GSS45 585911 321398749
GSS46 172776 150369921
GSS47 482732 359484724
GSS48 152735 105716923
GSS49 479119 374136202
GSS5 536938 294709940
GSS50 203437 126267998
GSS51 606791 347773427
GSS52 87651 57041080
GSS53 462295 351756795
GSS54 200794 128380249
GSS55 534780 304193558
GSS56 173097 78331501
GSS57 550605 311726285
GSS58 168220 79987296
GSS59 399167 307814698
GSS6 175718 90323279
GSS60 140506 112006346
GSS61 191812 159136714
GSS62 411776 338336075
GSS63 142406 112405669
GSS64 403234 325962624
GSS65 142862 120117095
GSS66 413177 335229827
GSS67 137857 113114394
GSS68 404638 324868198
GSS69 140643 117810168
GSS7 483637 250948919
GSS70 127182 92203837
GSS71 520909 323743563
GSS72 177517 102495279
GSS73 597632 395661030
GSS74 181036 126546097
GSS75 591119 414687777
GSS76 174298 134353538
GSS77 447817 251319447
GSS78 130318 57968790
GSS79 414776 307467555
GSS8 153561 95947803
GSS80 416891 261940117
GSS81 540328 348413356
GSS82 200211 139979325
GSS83 556164 409599797
GSS84 234505 111781688
GSS85 389319 246454652
GSS86 404418 350493972
GSS87 167924 158457537
GSS88 450647 353725576
GSS89 194833 131985347
GSS9 260253 131851340
GSS90 546296 347100745
GSS91 172886 121743136
GSS92 400359 246403089
GSS93 634003 413022963
GSS94 166388 136382073
GSS95 471133 373509240
GSS96 159807 141640417
GSS97 483856 431439713
GSS98 161900 124659678
GSS99 510919 344605321
HTC1 105590 213533747
HTC2 84852 50689748
HTC3 254863 284399082
HTC4 206260 192647591
HTG1 11398 1117560132
HTG10 4244 750053411
HTG11 5182 963529330
HTG12 5229 925700078
HTG13 5872 951465002
HTG14 5905 911954351
HTG15 5640 947566428
HTG16 5581 924865237
HTG17 5746 923702884
HTG18 5508 921042016
HTG19 5000 887751861
HTG2 5247 745343076
HTG20 5175 952063066
HTG21 7803 1147337632
HTG22 884 128257683
HTG23 8962 1119670148
HTG24 2952 336739408
HTG25 9544 1078904075
HTG26 7886 1058117822
HTG27 7154 1044981329
HTG28 6001 1063213749
HTG29 7669 1153930410
HTG3 5409 1144201139
HTG30 7331 990967405
HTG4 4824 728956388
HTG5 5091 1147003877
HTG6 3585 742321238
HTG7 5371 1144980645
HTG8 4025 736493117
HTG9 7138 1137709550
INV1 273522 651591349
INV10 2 74198017
INV100 255703 649137730
INV100 4 1094538185
INV100 224 467055727
INV100 48 1166873382
INV100 21 419145863
INV100 10 1154316587
INV100 49 1174737284
INV100 11 250196730
INV100 20 1127362232
INV100 6 591094294
INV100 39 1141924266
INV101 222476 930556764
INV101 10 392380997
INV101 36 1105816193
INV101 23 571175258
INV101 45 1121486358
INV101 17 612733718
INV101 40 1064976727
INV101 33 1183844491
INV101 3 21130809
INV101 14 1084968185
INV101 11 662670929
INV102 1014 103805595
INV102 34 1128073524
INV102 20 403806215
INV102 100 1183840214
INV102 70 225455574
INV102 42 1175039788
INV102 22 672550724
INV102 33 1114017454
INV102 27 741444754
INV102 20 1083179547
INV102 5 697761154
INV103 2061 424665927
INV103 9 1116821197
INV103 7 750167178
INV103 12 1121422029
INV103 40 1171870097
INV103 11 238542910
INV103 17 1161248546
INV103 2 191692686
INV103 19 1173452168
INV103 24 407364221
INV103 32 1139788145
INV104 1574 1167661346
INV104 5 317015352
INV104 40 1170289079
INV104 5 299724091
INV104 17 1161369887
INV104 5 495153017
INV104 6 1171254399
INV104 4 421752461
INV104 9 1160693900
INV104 6 643828914
INV104 13 1136352092
INV105 7 402809636
INV105 7 500547226
INV105 31 1165681365
INV105 24 545470219
INV105 57 1141878549
INV105 12 462839149
INV105 14 1101295629
INV105 6 557036769
INV105 12 1131940251
INV105 14 1169448537
INV105 37 1183354478
INV106 10436 1116731609
INV106 10 1182355777
INV106 5 1083758359
INV106 25 1168117365
INV106 10 181623502
INV106 47 1141906326
INV106 18 1147336069
INV106 2 162799272
INV106 51 1174106778
INV106 104 966217903
INV106 4 1071596713
INV107 251 1062752027
INV107 9 1107536877
INV107 5 517746926
INV107 23 885371414
INV107 4 1079695977
INV107 4 541647735
INV107 10 1104188691
INV107 11 648517594
INV107 31 1103328307
INV107 16 644222637
INV107 14 1141584802
INV108 18 224818646
INV108 6 509500711
INV108 17 1097666887
INV108 7 840025575
INV108 13 1174582815
INV108 27 728971417
INV108 96 1169235718
INV108 28 550779173
INV108 44 1164659070
INV108 35 567700567
INV108 49 1182496477
INV109 554 692519150
INV109 13 584433129
INV109 12 1158822560
INV109 4 546625252
INV109 11 1173505368
INV109 9 644175358
INV109 50 1175410754
INV109 23 590565952
INV109 13 1147119674
INV109 5 642987492
INV109 22 1183039088
INV11 76 1113171912
INV110 62285 1082080139
INV110 46 567268360
INV110 74 1167697820
INV110 47 634837186
INV110 25 1086430548
INV110 14 650442291
INV110 34 1104182557
INV110 8 677060987
INV110 17 1174324951
INV110 7 549278543
INV110 27 1156533044
INV111 58 1003563937
INV111 22 722546899
INV111 31 1066836765
INV111 6 673231088
INV111 22 1181460514
INV111 28 710409659
INV111 37 1161116214
INV111 24 592598993
INV111 23 1146169318
INV111 6 625440512
INV111 8 1141384454
INV112 83 1168097044
INV112 6 717797294
INV112 44 1178381589
INV112 68 784845291
INV112 29 1140183004
INV112 7 568695626
INV112 10 1015805994
INV112 5 858945147
INV112 7 1113582337
INV112 2 771986193
INV112 10 1138017652
INV113 69 1057913150
INV113 26 764599559
INV113 18 1178275412
INV113 7 592018368
INV113 20 1177344066
INV113 28 623103227
INV113 4 1093492567
INV113 6 818824109
INV113 39 1099101320
INV113 101457 488400767
INV114 80 1184050445
INV115 77 1049714291
INV116 42 1154779406
INV117 67 1092815201
INV118 85 1182280362
INV119 38 1033117817
INV12 91 471131477
INV120 75 1168447512
INV121 66 1070706122
INV122 63 1156639442
INV123 39 1062673391
INV124 68 1171356706
INV125 24 559740797
INV126 785 1168458093
INV127 38 867568161
INV128 1919 1155913703
INV129 49866 902911545
INV13 46 1171530708
INV130 386266 249047695
INV131 363946 255814468
INV132 388713 316361870
INV133 398865 366728383
INV134 390519 422404980
INV135 5116 648118531
INV136 375072 804114761
INV137 134726 1035626041
INV138 2738 196899005
INV139 191524 1022067857
INV14 80 1150944302
INV140 20756 153351994
INV141 293970 959751037
INV142 92482 210061842
INV143 581300 685904658
INV144 51170 774722748
INV145 515299 827183136
INV146 36237 407522252
INV147 303451 944797132
INV148 175942 749886502
INV149 565831 756340788
INV15 3 198694494
INV150 157721 1044896654
INV151 71786 24058474
INV152 310459 153115451
INV153 216088 85640379
INV154 344976 222123048
INV155 18669 15474032
INV156 421975 400429945
INV157 45818 500635082
INV158 22 974588403
INV159 4 890328438
INV16 11 1112643067
INV160 6 1081490781
INV161 30 811260112
INV162 66 1177591105
INV163 848 1169005163
INV164 57 1127636884
INV165 7 619986524
INV166 907 1171565747
INV167 46 750275070
INV168 74 1181479878
INV169 51 636905406
INV17 3 372536295
INV170 43 1179274307
INV171 23 676016352
INV172 71 1180229579
INV173 41 655310157
INV174 49 1154534586
INV175 25 717723274
INV176 52 1181888300
INV177 15 748459715
INV178 39 922230747
INV179 3 790776823
INV18 15 1153719157
INV180 55 1171906377
INV181 37 646464974
INV182 43 1077704944
INV183 3 518178978
INV184 8 1160095586
INV185 12 240338361
INV186 87 1156736911
INV187 8 257485661
INV188 52 1169774643
INV189 11 221047174
INV19 3 301970333
INV190 46 1153427693
INV191 35 286756574
INV192 128 1172709580
INV193 23 388833300
INV194 354 1171116774
INV195 7 91837211
INV196 78 1180820375
INV197 50 1027942734
INV198 68 1180107650
INV199 16 971455017
INV2 47292 945953140
INV20 58 1137115496
INV200 17 1165496987
INV201 20 350566973
INV202 24 1164459467
INV203 22 376361857
INV204 45 1182545330
INV205 205 1178290897
INV206 1 24136152
INV207 44 1183135012
INV208 43 1175092098
INV209 20 1145496549
INV21 74 370878243
INV210 31 1131526231
INV211 3 207382734
INV212 31 1177639892
INV213 19 451973159
INV214 69 1173407387
INV215 111 1153874644
INV216 49 1176483557
INV217 50 889122035
INV218 20 1144896249
INV219 24 1041963359
INV22 67 1151272942
INV220 4 1063536830
INV221 36 1180705104
INV222 5 332665299
INV223 34 1160207731
INV224 14 877876842
INV225 23 1156975077
INV226 15 423920453
INV227 31 1093958113
INV228 9 519441565
INV229 7 1139607402
INV23 22 843961302
INV230 63 1109671322
INV231 1 24908900
INV232 72 1151148414
INV233 36 1083051682
INV234 1 56992732
INV235 91 1182900759
INV236 63 903773652
INV237 65 905149830
INV238 5 818528617
INV239 1 429819325
INV24 10 1140548361
INV240 40 1136402179
INV241 24 1116534048
INV242 1 170575982
INV243 9 1164226515
INV244 6 365455225
INV245 117 1090567798
INV246 17 429990184
INV247 46 1172555234
INV248 21 1143550249
INV249 1 80753270
INV25 16 1149011874
INV250 35 1175867064
INV251 26 404720046
INV252 45 1092334003
INV253 3 271412684
INV254 49 1145824106
INV255 20 289723219
INV256 58 1183115041
INV257 18 419967033
INV258 36 1147123421
INV259 8 226290514
INV26 9 105123921
INV260 16 991169918
INV261 4 406800201
INV262 48 1172507997
INV263 14 854745958
INV264 25 1137368323
INV265 29 897524208
INV266 54 1180751072
INV267 12 758994876
INV268 8 1175209336
INV269 34 332964705
INV27 84 1121876247
INV270 27 1119084587
INV271 8 496368814
INV272 16 1180264612
INV273 16 444300333
INV274 15 1056245864
INV275 1 249620899
INV276 55 1168335732
INV277 13 420235976
INV278 15 1113905915
INV279 1 283143227
INV28 2 147220534
INV280 39 1128793024
INV281 4 404991268
INV282 22 1175706978
INV283 29 264157869
INV284 43 1178393287
INV285 27 362849337
INV286 73 1175149957
INV287 18 260465922
INV288 45 1182897844
INV289 50 578151589
INV29 273 1150778041
INV290 58 1136451976
INV291 31 676305088
INV292 40 1179394077
INV293 27 588929304
INV294 18 1153312885
INV295 6 656072283
INV296 47 1116444780
INV297 6 586961391
INV298 56 1139073482
INV299 9 815123865
INV3 182 1100986300
INV30 21 329075431
INV300 34 1143915167
INV301 34 616015109
INV302 7 1087036404
INV303 2 274114667
INV304 45 1097657805
INV305 21 257681977
INV306 44 1157371711
INV307 11 223039194
INV308 37 1169310417
INV309 3 203917285
INV31 96 1147375643
INV310 50 1008179751
INV311 1 253604678
INV312 6 1093677472
INV313 75 1080810493
INV314 1 280788551
INV315 6 1053198803
INV316 27 1160643322
INV317 9 402123374
INV318 19 1171895459
INV319 41 1072590683
INV32 87 331766739
INV320 9 246954501
INV321 61 1122234529
INV322 19 1165153296
INV323 10 278909029
INV324 47 1171770266
INV325 195 1175346174
INV326 1 98076447
INV327 14 1067550412
INV328 3 344572339
INV329 40 1181305379
INV33 59 1173456559
INV330 20 563360984
INV331 7 1135518446
INV332 47 945010083
INV333 26 1180724142
INV334 1 156731404
INV335 10 1129383166
INV336 33 868693962
INV337 30 1178102174
INV338 11 463097241
INV339 58 1161408728
INV34 9 185353717
INV340 33 1128854507
INV341 7 273110839
INV342 13 1138496972
INV343 20 1142259793
INV344 7 326451249
INV345 25 1109360043
INV346 34 505527850
INV347 23 979005798
INV348 7 650668978
INV349 47 1182856260
INV35 53 1181383201
INV350 8 428612167
INV351 36 1177609778
INV352 353 327501291
INV353 91 1111219876
INV354 2 395222208
INV355 32 1139499635
INV356 14 531893343
INV357 22 1168290851
INV358 20 920703115
INV359 24 1005476694
INV36 8 161061672
INV360 24 1075280211
INV361 24 1073193819
INV362 19 887662773
INV363 1 277791574
INV364 10 1140178047
INV365 8 305088483
INV366 12 1117452242
INV367 5 475109860
INV368 15 1056280104
INV369 13 677526847
INV37 54 1166920299
INV370 60 1126302065
INV371 6 694475755
INV372 15 1149400217
INV373 75 1172827857
INV374 1 111445931
INV375 21 1162514942
INV376 100 1137918226
INV377 1 49454665
INV378 16 1023275082
INV379 9 1058545407
INV38 10 218960568
INV380 2 199741241
INV381 48 1162240956
INV382 36 917259041
INV383 44 1181158046
INV384 61 897316651
INV385 52 1066888213
INV386 10 957238398
INV387 19 1167563966
INV388 31 1015110779
INV389 14 1103227811
INV39 54 1165175634
INV390 14 775609698
INV391 23 1161823502
INV392 28 1160290406
INV393 47 1176465275
INV394 50 899789306
INV395 44 1152337180
INV396 44 1110359249
INV397 3 236174852
INV398 19 1136968481
INV399 5 501056419
INV4 4 353796308
INV40 9 190916564
INV400 29 1165109564
INV401 20 460840775
INV402 57 1136284839
INV403 6 466441095
INV404 14 686304428
INV405 1 2140038457
INV406 1 1533311695
INV407 1 991394496
INV408 1 709211797
INV409 1 559013835
INV41 53 1176815245
INV410 2 1015231349
INV411 2 680734533
INV412 5 1139385694
INV413 9 387512797
INV414 38 1149151781
INV415 7 228551836
INV416 88 1181686129
INV417 27 316005074
INV418 42 1171516152
INV419 10 185290783
INV42 9 195418297
INV420 290 1181201554
INV421 10 173472662
INV422 42 1162946064
INV423 7 197461381
INV424 68 1176382137
INV425 7 193747225
INV426 8 1122120635
INV427 6 307813224
INV428 79 1149752287
INV429 5 262281928
INV43 57 1170845875
INV430 26 1180308804
INV431 12 255298002
INV432 75 1176675281
INV433 14 248327593
INV434 53 1172445280
INV435 22 384497843
INV436 8 1166380755
INV437 29 486152035
INV438 40 1178655921
INV439 17 418976310
INV44 10 195634974
INV440 70 1182031322
INV441 18 392152070
INV442 39 1095903520
INV443 4 302073392
INV444 8 1087090309
INV445 3 367875611
INV446 41 1173135983
INV447 17 272434458
INV448 66 1172783125
INV449 10 293162809
INV45 55 1147619569
INV450 66 1176229568
INV451 1 228165927
INV452 37 1127666342
INV453 11 364644469
INV454 19 1149393244
INV455 4 99463677
INV456 11 1168395548
INV457 17 520438381
INV458 45 1171051397
INV459 29 462890848
INV46 5 243308800
INV460 26 1132569772
INV461 18 520942289
INV462 92 1172843032
INV463 15 476627646
INV464 42 1168099605
INV465 26 446630606
INV466 67 1179117010
INV467 23 469119615
INV468 83 1154955445
INV469 30 758714569
INV47 70 1009927878
INV470 39 1159304171
INV471 10 241001718
INV472 51 1176823337
INV473 34 691532969
INV474 61 1172625068
INV475 30 682406867
INV476 61 1177272705
INV477 13 684254481
INV478 10 1058561635
INV479 26 1182289903
INV48 3 813113944
INV480 11 204132428
INV481 55 1177502155
INV482 18 333480790
INV483 16 1160054366
INV484 21 460474657
INV485 48 1163269519
INV486 20 404668265
INV487 61 1172247240
INV488 28 374991644
INV489 27 1152466269
INV49 4 1008855096
INV490 4 379512269
INV491 90 1119944238
INV492 2 445736338
INV493 52 1161767093
INV494 15 431557338
INV495 32 1155774498
INV496 210 1174645524
INV497 2 26385650
INV498 88 1170537753
INV499 67 1176827893
INV5 34 1183526385
INV50 4 513393835
INV500 6 71363600
INV501 54 1165537031
INV502 19 379601315
INV503 44 1155919506
INV504 237 1056358889
INV505 2 378921420
INV506 32 1181647471
INV507 7 270001607
INV508 21 1171629453
INV509 14 461010674
INV51 38 1167088645
INV510 39 1171071737
INV511 14 342166681
INV512 55 1182543996
INV513 19 687804564
INV514 46 1163466471
INV515 44 726113674
INV516 68 1172006473
INV517 25 660741114
INV518 37 1164238669
INV519 37 767043879
INV52 144 307543456
INV520 69 1174894340
INV521 23 780407278
INV522 56 1179305319
INV523 39 1056010852
INV524 39 1170436008
INV525 349 1099604861
INV526 27 1170787413
INV527 51 1063483092
INV528 17 1097419755
INV529 5 589296853
INV53 21 1182740529
INV530 8 1109183115
INV531 2 387387157
INV532 292 1180288671
INV533 29 491164617
INV534 50 1166566430
INV535 14 349281667
INV536 18 1180940926
INV537 15 543636569
INV538 86 1160906063
INV539 22 580569362
INV54 12 635433843
INV540 54 1165239523
INV541 17 532351739
INV542 53 1162873867
INV543 28 547508741
INV544 59 1174117998
INV545 12 275890767
INV546 56 1176591424
INV547 11 282091255
INV548 37 1176450817
INV549 3 300075750
INV55 69 1175995880
INV550 17 1170398473
INV551 10 366145546
INV552 15 1183808923
INV553 29 692214430
INV554 68 1176081176
INV555 35 694701543
INV556 15 1170602412
INV557 68 1140944349
INV558 11 318389619
INV559 16 1125800549
INV56 153080 691355611
INV560 57 1181357371
INV561 11 176643969
INV562 284 1170549510
INV563 59 1163463453
INV564 49 1161552391
INV565 8 219178196
INV566 39 1176853398
INV567 5 184919638
INV568 16 1103067893
INV569 2 202273058
INV57 293975 246630288
INV570 7 1157443359
INV571 21 1168831763
INV572 1 281865375
INV573 37 1107189921
INV574 3 329372380
INV575 18 1166415167
INV576 10 401689523
INV577 55 1170958356
INV578 11 242378568
INV579 98 1169276834
INV58 39960 1040714467
INV580 13 234291481
INV581 23 1173442542
INV582 8 235471396
INV583 38 1059108018
INV584 6 313828708
INV585 64 1115037913
INV586 7 266485410
INV587 37 1173211015
INV588 14 224821814
INV589 46 1163337646
INV59 28 430019538
INV590 8 239800496
INV591 28 1169424257
INV592 56 1178676774
INV593 6 147326465
INV594 54 1163647121
INV595 28 1149969800
INV596 10 1017199002
INV597 1 210654766
INV598 7 1148462765
INV599 2 472390081
INV6 19 297443214
INV60 78 1183112976
INV600 46 1157706722
INV601 13 349630037
INV602 54 1149819012
INV603 10 355608178
INV604 58 1091215982
INV605 11 1035200436
INV606 268 1159772212
INV607 38 1113515607
INV608 1 136390895
INV609 46 1164437507
INV61 21 476524808
INV610 40 826957687
INV611 58 1179315760
INV612 6 1042444597
INV613 7 1073935065
INV614 3 433618882
INV615 40 1131808525
INV616 5 602836935
INV617 33 1172252413
INV618 11 302594749
INV619 35 1181281402
INV62 51 1168013818
INV620 73 1109484795
INV621 3 222808546
INV622 46 1175005023
INV623 13 110326208
INV624 45 1173155884
INV625 90 1180518783
INV626 2 158346272
INV627 50 1076844844
INV628 7 1132104668
INV629 2 359154098
INV63 27 491070241
INV630 10 1126653575
INV631 49 1155057985
INV632 16 1148926863
INV633 12 479432118
INV634 46 1150819712
INV635 11 309050588
INV636 66 1178761552
INV637 18 320380910
INV638 64 1179620404
INV639 25 708995082
INV64 102 1179177240
INV640 52 1182802979
INV641 20 331581745
INV642 57 1174098934
INV643 62 1073493620
INV644 40 1141758017
INV645 5 328685949
INV646 33 1174621744
INV647 30 491303488
INV648 35 1050226528
INV649 11 616512980
INV65 56 1117926882
INV650 19 1179887530
INV651 7 283887005
INV652 26 1180576662
INV653 5 576348716
INV654 11 696616259
INV655 4 1098480882
INV656 4 247410792
INV657 23 1164742126
INV658 33 804514616
INV659 30 1161344665
INV66 1 94407144
INV660 13 782319430
INV661 35 1181577893
INV662 46 723533343
INV663 22 1048373506
INV664 12 1020694987
INV665 53 1174510426
INV666 36 835900437
INV667 8 1038095140
INV668 13 1180329439
INV669 16 457486952
INV67 70 1177732067
INV670 9 1057568269
INV671 14 816084135
INV672 15 1140373678
INV673 3 399837115
INV674 24 1129639943
INV675 36 1174157392
INV676 12 148689426
INV677 20 1172698862
INV678 75 1176515731
INV679 10 113467994
INV68 221447 689503442
INV680 77 1168430039
INV681 87 1149071185
INV682 18 1128928755
INV683 22 1177260315
INV684 14 443398168
INV685 23 1115796990
INV686 13 1159346242
INV687 43 1181378857
INV688 26 707439366
INV689 30 1148523519
INV69 57903 1055436434
INV690 13 346240109
INV691 21 1105128801
INV692 12 524632913
INV693 50 1168023395
INV694 219 613294418
INV695 79 1143758856
INV696 10 506376177
INV697 55 1166742844
INV698 27 494226509
INV699 65 1165986797
INV7 74 1181961575
INV70 31 641837690
INV700 20 545455033
INV701 42 1180405673
INV702 18 421482089
INV703 29 1076309014
INV704 2 526950202
INV705 7 1014602742
INV706 3 348958771
INV707 10 1136361044
INV708 71 975019307
INV709 38 1149622989
INV71 129 1172100674
INV710 6 941961830
INV711 23 1036981527
INV712 1 195322241
INV713 46 1183891356
INV714 115 318736649
INV715 22 1176694479
INV716 4 197954523
INV717 55 1166415842
INV718 25 431770977
INV719 15 1153744291
INV72 41 759510965
INV720 18 599941963
INV721 58 1133439408
INV722 25 1172100353
INV723 4 287023245
INV724 20 1177928500
INV725 6 289987563
INV726 63 1183668969
INV727 22 871804317
INV728 10 1178565949
INV729 83 959294373
INV73 80 1177018882
INV730 84 1173318646
INV731 32 983614572
INV732 17 984681430
INV733 5 1160167511
INV734 4 968383396
INV735 5 1031138611
INV736 1 173785391
INV737 9 1175857115
INV738 12 1071919900
INV739 57 1112765851
INV74 160 732432812
INV740 3 285907573
INV741 33 1172526206
INV742 20 387866850
INV743 211 1157698378
INV744 55 951167692
INV745 51 1183206605
INV746 33 287912197
INV747 81 1166057898
INV748 5 333567415
INV749 7 1157771555
INV75 64 1183132455
INV750 2 282252146
INV751 22 1159672490
INV752 78 1146550131
INV753 34 1171027121
INV754 24 1078182774
INV755 1 141120907
INV756 31 1175918517
INV757 60 1173881038
INV758 1 38566108
INV759 32 1144571011
INV76 29 649840505
INV760 40 1101227863
INV761 2 200113839
INV762 15 1173091833
INV763 3 549536089
INV764 11 1151234513
INV765 20 643334565
INV766 66 1167559863
INV767 30 582603137
INV768 56 961445692
INV769 4 826129831
INV77 80 1180694422
INV770 7 1122891217
INV771 6 773654805
INV772 47 1167507163
INV773 37 803146093
INV774 26 1175621680
INV775 29 773698835
INV776 12 1170789341
INV777 24 399325876
INV778 21 1055389927
INV779 4 529490845
INV78 48 674849506
INV780 10 1145847553
INV781 4 385903968
INV782 14 1152569863
INV783 13 523646868
INV784 52 1140818398
INV785 8 552177835
INV786 38 1167924385
INV787 13 535556260
INV788 58 1166124907
INV789 32 610996274
INV79 70 1175199456
INV790 35 1182656851
INV791 30 815614629
INV792 1 540902015
INV793 5 1135738023
INV794 46 1175547441
INV795 9 355981500
INV796 26 1175124510
INV797 4 562554156
INV798 201 1166190476
INV799 16 620203581
INV8 37341 619568638
INV80 50 646679960
INV800 34 1125184633
INV801 9 621148114
INV802 26 1163552733
INV803 20 1135116210
INV804 5 202644379
INV805 29 1171916326
INV806 19 493858152
INV807 22 1179258290
INV808 14 680932278
INV809 9 1159699274
INV81 66 1178213441
INV810 12 964112763
INV811 40 1142294771
INV812 7 1000175726
INV813 2 506163426
INV814 37 1135047917
INV815 41 696194464
INV816 45 907408615
INV817 25 957087174
INV818 13 837980818
INV819 16 1009224553
INV82 17 214525417
INV820 53 1174974874
INV821 45 747358929
INV822 44 1159975558
INV823 11 322493981
INV824 48 1174245902
INV825 26 847474578
INV826 57 1161546715
INV827 28 859874329
INV828 56 1181449801
INV829 18 286553490
INV83 193867 816205312
INV830 29 1173501732
INV831 5 325923863
INV832 58 1179409688
INV833 27 330554813
INV834 49 1164814455
INV835 17 268867432
INV836 54 1172339728
INV837 15 828226304
INV838 22 924352601
INV839 1 268156038
INV84 29120 21131779
INV840 43 1139934415
INV841 16 466545463
INV842 24 1180888142
INV843 5 98179301
INV844 8 1166224888
INV845 29 1171022807
INV846 3 71931701
INV847 8 1056477253
INV848 2 579379686
INV849 21 1161892934
INV85 423441 304020150
INV850 50 831753780
INV851 1 530134936
INV852 7 1095668864
INV853 2 233312597
INV854 11 1131682103
INV855 36 376356686
INV856 41 1131505858
INV857 3 345957582
INV858 8 987372027
INV859 2 482999942
INV86 363150 270592460
INV860 11 1179162941
INV861 20 414948321
INV862 40 1173054389
INV863 12 254279101
INV864 30 1107116022
INV865 4 333912884
INV866 38 1164789604
INV867 49 1183261514
INV868 71 1102398920
INV869 18 1100700778
INV87 345692 259117628
INV870 1 416981589
INV871 3 1157463834
INV872 3 1060904444
INV873 2 611623168
INV874 4 1106412385
INV875 39 912374424
INV876 2 661038697
INV877 5 1137688336
INV878 16 1154482827
INV879 31 451974996
INV88 334242 216414498
INV880 21 1090976566
INV881 6 479966501
INV882 50 1089322010
INV883 4 346159624
INV884 8 1160538827
INV885 9 618678086
INV886 10 928627153
INV887 1 480241822
INV888 2 951616379
INV889 2 871667885
INV89 330476 204444184
INV890 2 818376178
INV891 2 729282197
INV892 3 961516656
INV893 18 854853893
INV894 16 890707862
INV895 2 577657875
INV896 34 1139635994
INV897 5 727905464
INV898 8 1063877851
INV899 5 590149535
INV9 129381 906404418
INV90 330020 200921246
INV900 11 1152684900
INV901 8 710744595
INV902 36 1166405653
INV903 10 625620248
INV904 19 1112325788
INV905 25 707449545
INV906 37 1002045037
INV907 8 1027154230
INV908 9 744708688
INV909 1 693712867
INV91 349267 240963088
INV910 1 690419613
INV911 1 688810701
INV912 1 639929110
INV913 1 625027500
INV914 1 623195831
INV915 1 617718696
INV916 2 1167479169
INV917 2 1124973432
INV918 2 972905134
INV919 3 915669535
INV92 446483 346835337
INV920 33 1175819391
INV921 17 337246022
INV922 35 1182263806
INV923 9 433016709
INV924 10 1134155138
INV925 17 736154490
INV926 40 1177080951
INV927 30 686206625
INV928 38 1144573634
INV929 24 1059642536
INV93 167977 281122816
INV930 12 1146055021
INV931 16 426715246
INV932 63 1164968250
INV933 19 776727519
INV934 3 1143035150
INV935 42 1134241877
INV936 13 1168959675
INV937 2 442951563
INV938 6 1166259661
INV939 4 643924932
INV94 399263 402818845
INV940 35 1175805876
INV941 9 512843503
INV942 16 1173233554
INV943 48 1172588912
INV944 7 236034213
INV945 62 1142249551
INV946 14 1124386096
INV947 15 438382888
INV948 40 1176398187
INV949 42 1147439138
INV95 38629 187147326
INV950 5 186802489
INV951 28 1113540571
INV952 25 1183920083
INV953 7 278388585
INV954 30 1179924498
INV955 6 543566409
INV956 25 1183567352
INV957 27 636126639
INV958 17 1147278217
INV959 196 610552163
INV96 800 42674647
INV960 26 1054305302
INV961 2 416648436
INV962 44 1165602779
INV963 23 537428299
INV964 31 1155380117
INV965 4 443902968
INV966 17 1181298860
INV967 15 441864740
INV968 34 1168049254
INV969 10 282815994
INV97 566 40635863
INV970 28 1140507194
INV971 17 466627605
INV972 30 1112641054
INV973 2 445716186
INV974 9 1085975686
INV975 25 642693539
INV976 30 1156609619
INV977 29 560632156
INV978 33 1051507514
INV979 2 795197424
INV98 8037 115580217
INV980 11 1170879383
INV981 41 961367314
INV982 21 1142240940
INV983 9 874060652
INV984 12 1174977387
INV985 18 860732275
INV986 19 1163517885
INV987 15 822446859
INV988 12 1137593010
INV989 15 1094577995
INV99 46584 504877383
INV990 3 480601000
INV991 51 1183760112
INV992 2 235147018
INV993 22 1165027366
INV994 26 452267105
INV995 2 940631047
INV996 2 928744483
INV997 2 883129211
INV998 3 1143834446
INV999 1 295284678
MAM1 54649 917178765
MAM10 3 308153814
MAM100 2 272528628
MAM101 8 1171546937
MAM102 3 311079698
MAM103 19 1111022050
MAM104 1 178365832
MAM105 9 1137930415
MAM106 4 370992980
MAM107 12 1061089740
MAM108 2 296330659
MAM109 10 1109747736
MAM11 15 1037946112
MAM110 3 260392119
MAM111 10 1145323782
MAM112 2 211903297
MAM113 10 1116587684
MAM114 8 367669076
MAM115 12 1121894092
MAM116 6 418702010
MAM117 16 1015883955
MAM118 4 651631450
MAM119 11 1156896317
MAM12 12 1137706418
MAM120 10 658511106
MAM121 11 1138344427
MAM122 165 648612555
MAM123 7 1147702881
MAM124 27 953979977
MAM125 5 1086466071
MAM126 12 1073178649
MAM127 1 188105751
MAM128 8 1101390325
MAM129 15 1074262986
MAM13 1 103782134
MAM130 6 1125669670
MAM131 6 774631741
MAM132 12 1132049837
MAM133 18 1085536552
MAM134 3 320447314
MAM135 12 1178815323
MAM136 5 242278661
MAM137 47 1064535464
MAM138 3 418271949
MAM139 12 1168086867
MAM14 19 1127022250
MAM140 6 791898128
MAM141 12 1138729465
MAM142 11 658641730
MAM143 7 1170582831
MAM144 16 875048119
MAM145 7 1070781583
MAM146 12 1145013723
MAM147 4 156566841
MAM148 5 1162556979
MAM149 14 1169511893
MAM15 6 417335826
MAM150 2 112310364
MAM151 12 1109808165
MAM152 19 1171295571
MAM153 4 219237353
MAM154 8 1131294285
MAM155 8 726228234
MAM156 24 1070356570
MAM157 8 799447878
MAM158 19 1177960816
MAM159 7 731882456
MAM16 20 1114156407
MAM160 14 1164148358
MAM161 6 349193395
MAM162 12 1179433182
MAM163 4 397773065
MAM164 14 1041093991
MAM165 2 481778387
MAM166 5 1056405742
MAM167 4 577359420
MAM168 9 1094931139
MAM169 3 431583879
MAM17 8 440415269
MAM170 9 1044771416
MAM171 3 562951973
MAM172 8 1139744895
MAM173 4 450697867
MAM174 6 999063376
MAM175 3 667074377
MAM176 9 1168010004
MAM177 4 606841363
MAM178 19 1183539355
MAM179 6 784240423
MAM18 18 1173305826
MAM180 11 1178122221
MAM181 9 737268083
MAM182 8 1101462276
MAM183 16 1078311755
MAM184 2 316056605
MAM185 8 1079365254
MAM186 12 1095616644
MAM187 5 508765777
MAM188 21 1122151370
MAM189 8 1177121225
MAM19 5 246617504
MAM190 3 248576942
MAM191 14 1135919499
MAM192 13 1178666772
MAM193 12703 282421335
MAM2 2 376685399
MAM20 16 1178104214
MAM21 10 836799539
MAM22 10 1171820346
MAM23 12 1029020087
MAM24 10 1131536607
MAM25 14 1173052009
MAM26 1 63378952
MAM27 12 1121924900
MAM28 11 1149027118
MAM29 2 152741918
MAM3 9 1159833615
MAM30 14 1148411493
MAM31 8 1166480673
MAM32 1 99521505
MAM33 16 1127667099
MAM34 6 1067566260
MAM35 2 244257932
MAM36 14 1127597170
MAM37 10 1128331415
MAM38 1 125837387
MAM39 13 1161587569
MAM4 936 397469053
MAM40 13 1107165634
MAM41 1 126212105
MAM42 10 1098388989
MAM43 16 1043211313
MAM44 2 312461551
MAM45 10 1156184385
MAM46 16 1138379370
MAM47 10 198979284
MAM48 54 7614329
MAM49 215 34073042
MAM5 26814 24994146
MAM50 431 71272130
MAM51 861 68509101
MAM52 1706 2411269
MAM53 6879 6176592
MAM54 110526 193403794
MAM55 33201 1099561407
MAM56 16 932399762
MAM57 253353 712925912
MAM58 6291 721820212
MAM59 1 662751787
MAM6 13731 20581276
MAM60 1 611347268
MAM61 5 1091124403
MAM62 4 833121924
MAM63 9 1173688690
MAM64 370 631762200
MAM65 11 1148682982
MAM66 265 655228071
MAM67 14 1129485591
MAM68 10 780461055
MAM69 12 1154949216
MAM7 3445 7368868
MAM70 11 821210834
MAM71 3346 1174847022
MAM72 208852 651960300
MAM73 14 1092077466
MAM74 14 1163101092
MAM75 279 336844158
MAM76 6 1088563449
MAM77 11 1170209443
MAM78 4 257416099
MAM79 396 1126820426
MAM8 107 699953
MAM80 11 1123823459
MAM81 28 322280472
MAM82 9 1118303675
MAM83 15 1166025468
MAM84 6 401152657
MAM85 8 1076435216
MAM86 2 226942227
MAM87 14 1132032412
MAM88 271 307742124
MAM89 6 1084909688
MAM9 24 978923755
MAM90 5 579063099
MAM91 13 1159289868
MAM92 2 319966445
MAM93 10 1125919330
MAM94 9 578892446
MAM95 11 1080315572
MAM96 11 752575683
MAM97 17 1117115584
MAM98 5 616253053
MAM99 10 1124329418
PAT1 799937 380650087
PAT10 271895 194870018
PAT100 855295 50272813
PAT101 96566 20012584
PAT102 893771 125915996
PAT103 790992 623139960
PAT104 565823 806468807
PAT105 779693 427337725
PAT106 815031 321652669
PAT107 666368 321225487
PAT108 403661 109815449
PAT109 728138 463603491
PAT11 695316 537302870
PAT110 309223 438941075
PAT12 616745 312423158
PAT13 550435 336234424
PAT14 558843 479644330
PAT15 97886 9820533
PAT16 618968 522600188
PAT17 98835 382939732
PAT18 797352 222348162
PAT19 31170 33403474
PAT2 809085 544871876
PAT20 804548 303117725
PAT21 92453 1756607
PAT22 846018 25272339
PAT23 846018 16403244
PAT24 936830 589670636
PAT25 707138 139681125
PAT26 754654 539398031
PAT27 1095352 307304135
PAT28 610387 236245640
PAT29 520675 733807170
PAT3 625018 303686612
PAT30 630876 626582223
PAT31 725834 389970554
PAT32 725834 350765074
PAT33 808618 106711475
PAT34 614454 198519627
PAT35 706858 516368864
PAT36 161614 40889134
PAT37 1047866 19909454
PAT38 720643 78270616
PAT39 685448 388769770
PAT4 623619 423631098
PAT40 776835 341284579
PAT41 925604 622455932
PAT42 130468 96635421
PAT43 836770 697037292
PAT44 219302 91982645
PAT45 478398 369730555
PAT46 465573 363885306
PAT47 538688 501452614
PAT48 1460 4603802
PAT49 478541 109414935
PAT5 635000 361815202
PAT50 275396 358965751
PAT51 229252 116776485
PAT52 504649 200780045
PAT53 688229 330989793
PAT54 517739 781723621
PAT55 696501 289726628
PAT56 696501 196685805
PAT57 1175480 45090107
PAT58 623122 230103271
PAT59 455428 838741066
PAT6 633134 411695605
PAT60 455428 365884940
PAT61 325231 482206711
PAT62 121982 154449698
PAT63 447213 131724501
PAT64 1032880 196383084
PAT65 227776 118142255
PAT66 802491 187547556
PAT67 737903 168772635
PAT68 65066 7149938
PAT69 300935 428633458
PAT7 751932 290746139
PAT70 312425 86908455
PAT71 661692 354755134
PAT72 105706 68110226
PAT73 635967 172920982
PAT74 7667 115005
PAT75 600007 253224862
PAT76 22948 34610499
PAT77 387425 636579263
PAT78 6530 8858406
PAT79 482746 437258099
PAT8 146946 94872615
PAT80 309975 73656137
PAT81 671487 154795521
PAT82 246652 90238309
PAT83 234681 377596830
PAT84 208569 85618676
PAT85 1025193 21516964
PAT86 331154 110021550
PAT87 743946 592297584
PAT88 601967 722579971
PAT89 572273 786734443
PAT9 704058 375636088
PAT90 620176 688425199
PAT91 790292 652398354
PAT92 304117 76037493
PAT93 512789 752893376
PAT94 826524 599374610
PAT95 643350 725078440
PAT96 629482 818364735
PAT97 381127 520363322
PAT98 701249 321706883
PAT99 558446 41542650
PHG1 18917 659342130
PHG2 16355 686712522
PHG3 11771 213304601
PLN1 182369 828375546
PLN10 158 829520559
PLN100 57 1173826657
PLN100 1 626868012
PLN100 1 607094319
PLN100 2 1149874108
PLN100 2 1149787837
PLN100 1 656602423
PLN100 1 622110859
PLN100 1 612883152
PLN100 2 1142529769
PLN100 2 1154234909
PLN100 1 656789389
PLN101 8 204748821
PLN101 1 625372561
PLN101 1 603451504
PLN101 2 1159731212
PLN101 2 1150269419
PLN101 1 657552530
PLN101 1 618447767
PLN101 1 613586716
PLN101 2 1143934454
PLN101 1 631620540
PLN101 1 521019562
PLN102 35 1162360688
PLN102 1 676241010
PLN102 1 632313166
PLN102 1 603807353
PLN102 2 1155326502
PLN102 2 1150412865
PLN102 1 662000247
PLN102 1 633487160
PLN102 1 612164168
PLN102 1 594048367
PLN102 1 565074362
PLN103 73 724972614
PLN103 2 1150238410
PLN103 1 660449817
PLN103 1 627269420
PLN103 1 602651360
PLN103 2 1162506895
PLN103 2 1158496591
PLN103 1 664401522
PLN103 1 626503588
PLN103 1 611188438
PLN103 2 1171231026
PLN104 53 1151777365
PLN104 1 639824632
PLN104 2 1173957386
PLN104 1 621715108
PLN104 1 610707416
PLN104 1 589489225
PLN104 1 558356414
PLN104 2 1151723189
PLN104 1 660500976
PLN104 1 634743673
PLN104 1 616002081
PLN105 10 661759416
PLN105 2 1150169128
PLN105 2 1153490048
PLN105 1 669356984
PLN105 1 631173187
PLN105 1 607766370
PLN105 2 1145806163
PLN105 2 1143277701
PLN105 1 664077638
PLN105 1 624178744
PLN105 1 609451706
PLN106 72 1160482328
PLN106 2 1144639091
PLN106 1 631526965
PLN106 1 660034972
PLN106 1 625104971
PLN106 1 608830648
PLN106 2 1146797356
PLN106 2 1146984767
PLN106 1 526310788
PLN106 1 664689228
PLN106 1 632403820
PLN107 8 360700132
PLN107 1 613638454
PLN107 2 1172960765
PLN107 2 1147017396
PLN107 1 660476038
PLN107 1 624334204
PLN107 1 613769411
PLN107 1 589927450
PLN107 1 557572468
PLN107 2 1148490360
PLN107 1 663019822
PLN108 53 1161097665
PLN108 1 626669531
PLN108 1 612901747
PLN108 2 1150057662
PLN108 2 1157797487
PLN108 1 667210568
PLN108 1 635382001
PLN108 1 614569426
PLN108 2 1169192410
PLN108 2 1163716432
PLN108 1 626973123
PLN109 55 803570774
PLN109 1 611284754
PLN109 2 1150481064
PLN109 1 659290088
PLN109 2 1150737255
PLN109 1 660553991
PLN109 1 632999331
PLN109 1 616334843
PLN109 1 595538521
PLN109 1 579057524
PLN109 2 1159220941
PLN11 4 1049626460
PLN110 98 1103828295
PLN110 1 659217363
PLN110 1 627225202
PLN110 1 611858135
PLN110 2 1164391514
PLN110 2 1152376894
PLN110 1 660591081
PLN110 1 627080904
PLN110 1 609113147
PLN110 2 1138662036
PLN110 1 628475395
PLN111 4 295727713
PLN111 1 525655293
PLN111 1 659787933
PLN111 1 626680366
PLN111 1 612118009
PLN111 1 587712295
PLN111 1 559096804
PLN111 2 1153763781
PLN111 1 662624081
PLN111 1 626502968
PLN111 1 614857888
PLN112 16 1123654509
PLN112 2 1161694293
PLN112 2 1153142705
PLN112 1 669220190
PLN112 1 629226312
PLN112 1 613110551
PLN112 2 1144904879
PLN112 2 1160236768
PLN112 1 658438119
PLN112 1 628047470
PLN112 1 612916554
PLN113 5 374350710
PLN113 2 1143852611
PLN113 2 1150763450
PLN113 1 657631428
PLN113 1 629616096
PLN113 1 610488678
PLN113 2 1145704528
PLN113 2 1148031132
PLN113 1 655385637
PLN113 1 626286153
PLN113 1 610690180
PLN114 16 1141675300
PLN114 2 1141737084
PLN114 2 1145450335
PLN114 1 659936173
PLN114 1 627661034
PLN114 1 608478632
PLN114 2 1164887918
PLN114 2 1157801119
PLN114 1 654540277
PLN114 1 624453744
PLN114 1 610565479
PLN115 5 342976815
PLN115 2 1154225896
PLN115 2 1144646810
PLN115 1 661109612
PLN115 1 624188817
PLN115 1 609603980
PLN115 2 1153106963
PLN115 2 1149274143
PLN115 1 657668641
PLN115 1 627263816
PLN115 1 611107145
PLN116 16 1144877896
PLN116 2 1143888586
PLN116 2 1151475536
PLN116 1 659552134
PLN116 1 627284235
PLN116 1 612025601
PLN116 2 1148289352
PLN116 2 1155467049
PLN116 1 660627594
PLN116 1 636764043
PLN116 1 612684114
PLN117 5 345215612
PLN117 2 1172404752
PLN117 2 1143811555
PLN117 1 660087335
PLN117 1 626870575
PLN117 1 607666773
PLN117 1 586243134
PLN117 1 573947504
PLN117 2 1151319163
PLN117 1 663157241
PLN117 1 626857742
PLN118 16 1135577683
PLN118 1 607587567
PLN118 2 1166417974
PLN118 2 1149892400
PLN118 1 660726353
PLN118 1 625613366
PLN118 1 606853752
PLN118 1 591973374
PLN118 2 1181333537
PLN118 1 520737098
PLN118 1 659649991
PLN119 5 340881447
PLN119 1 630477981
PLN119 1 612914000
PLN119 1 592900278
PLN119 1 566194267
PLN119 1 634521465
PLN119 2 1178059891
PLN119 1 626766831
PLN119 1 610506001
PLN119 2 1139699259
PLN119 1 626388232
PLN12 1 267785325
PLN120 16 1142305581
PLN120 1 525410090
PLN120 1 659109138
PLN120 1 625619081
PLN120 1 605020174
PLN120 2 1144201423
PLN120 2 1150772597
PLN120 1 660123737
PLN120 1 626033862
PLN120 1 611584699
PLN120 2 1146634294
PLN121 5 358843749
PLN121 1 629468067
PLN121 2 1181536715
PLN121 1 634780758
PLN121 1 613857241
PLN121 2 1153523653
PLN121 2 1157943603
PLN121 1 655608708
PLN121 1 630476109
PLN121 1 611734907
PLN121 2 1148834704
PLN122 16 1159245186
PLN122 2 1153026048
PLN122 1 660958633
PLN122 1 628850999
PLN122 1 613418293
PLN122 1 593424848
PLN122 1 555705214
PLN122 2 1149230152
PLN122 1 662192201
PLN122 1 624651312
PLN122 1 607896916
PLN123 4 291276224
PLN123 2 1144733231
PLN123 1 627906795
PLN123 2 1180743776
PLN123 1 626336238
PLN123 1 607408596
PLN123 2 1149881386
PLN123 2 1156807113
PLN123 1 662539114
PLN123 1 634696490
PLN123 1 614659814
PLN124 75 1094238305
PLN124 2 1155079160
PLN124 2 1150818685
PLN124 1 657222892
PLN124 1 629605540
PLN124 1 613053250
PLN124 2 1144594366
PLN124 2 1153001227
PLN124 1 663034619
PLN124 1 623546353
PLN124 1 613383894
PLN125 1 494422770
PLN125 2 1145099380
PLN125 7 800846786
PLN125 43 1165400665
PLN125 27 869035869
PLN125 5 1034335425
PLN125 5 973412539
PLN125 1 454733196
PLN125 2 877648901
PLN125 1 379526086
PLN125 11 1184012898
PLN126 1 646201372
PLN126 9 226764577
PLN126 27 712893091
PLN126 1 520479541
PLN126 1 655484837
PLN126 1 626855960
PLN126 1 604911185
PLN126 1 592828626
PLN126 1 553427711
PLN126 2 1152814527
PLN126 1 631897805
PLN127 1 587623253
PLN127 1 637173558
PLN127 1 641960388
PLN127 2 1176182574
PLN127 2 1155488842
PLN127 1 660305412
PLN127 1 629753639
PLN127 1 609200707
PLN127 2 1175561398
PLN127 1 633965700
PLN127 2 1180215838
PLN128 1 663525381
PLN128 1 627226266
PLN128 1 603942392
PLN128 2 1145038912
PLN128 2 1141862336
PLN128 1 661554418
PLN128 1 627699516
PLN128 1 609498991
PLN128 1 588006371
PLN128 1 560132838
PLN128 51 1161837995
PLN129 2 1170194602
PLN129 8 126267343
PLN129 32 1131142309
PLN129 1 369077699
PLN129 1 639092456
PLN129 1 650132723
PLN129 2 1119308834
PLN129 1 734473537
PLN129 2 1100022842
PLN129 2 990953513
PLN129 2 1156725275
PLN13 4 963836134
PLN130 52 1140868282
PLN130 2 921884013
PLN130 1 588888971
PLN130 2 968927852
PLN130 2 1122645515
PLN130 14 393517910
PLN130 35 1168755904
PLN130 3 198866682
PLN130 65 1175961107
PLN130 43 528340211
PLN130 42 792175415
PLN131 3 282488941
PLN131 1 646201372
PLN131 1 587623253
PLN131 1 663525381
PLN131 2 1170194602
PLN131 2 684606446
PLN131 1 525133463
PLN131 1 663523538
PLN131 1 635405230
PLN131 1 611936476
PLN131 2 1150154113
PLN132 61 1124765676
PLN132 2 1161072711
PLN132 1 660736956
PLN132 1 627598042
PLN132 1 612187513
PLN132 2 1155070448
PLN132 1 627617921
PLN132 1 518127376
PLN132 1 673406957
PLN132 1 630137118
PLN132 1 612939186
PLN133 4 316808231
PLN133 2 1151335502
PLN133 2 1155631783
PLN133 1 657661460
PLN133 1 626889213
PLN133 1 610003100
PLN133 2 1148528258
PLN133 1 626222545
PLN133 2 1182281996
PLN133 1 630354994
PLN133 1 612387238
PLN134 35 1154801519
PLN134 1 588087319
PLN134 1 567667584
PLN134 2 1149070389
PLN134 1 653250953
PLN134 1 631324550
PLN134 1 609093722
PLN134 2 1149523883
PLN134 2 1145083390
PLN134 1 655260812
PLN134 1 634191159
PLN135 33 903586639
PLN135 1 614681618
PLN135 1 597998838
PLN135 1 574769137
PLN135 2 1152836532
PLN135 1 658721539
PLN135 1 626163282
PLN135 1 609194012
PLN135 2 1153379980
PLN135 2 1162676726
PLN135 1 656359106
PLN136 42 1153994395
PLN136 1 622273932
PLN136 1 610730036
PLN136 1 596985997
PLN136 1 555033258
PLN136 2 1150333174
PLN136 1 657708949
PLN136 1 625240013
PLN136 1 610861510
PLN136 2 1136292166
PLN136 1 630182139
PLN137 37 1012187192
PLN137 2 1179461484
PLN137 1 624169276
PLN137 1 611474174
PLN137 2 1152158626
PLN137 2 1154678582
PLN137 1 664634244
PLN137 1 643202471
PLN137 1 617103718
PLN137 2 1161114768
PLN137 1 645264326
PLN138 43 1174230866
PLN138 2 1178750198
PLN138 1 634680428
PLN138 1 612896067
PLN138 2 1153985512
PLN138 2 1159127655
PLN138 1 658111403
PLN138 1 631828453
PLN138 1 612358733
PLN138 2 1172628206
PLN138 2 1161043722
PLN139 35 977765170
PLN139 1 661402595
PLN139 1 635870417
PLN139 1 617906818
PLN139 2 1154505804
PLN139 1 639539621
PLN139 1 522184041
PLN139 1 666500271
PLN139 1 632086707
PLN139 1 607961820
PLN139 2 1173780312
PLN14 118 388802600
PLN140 44 1183169112
PLN140 21 1134943785
PLN140 25 978183503
PLN140 31 1162575117
PLN140 11 428279349
PLN140 10 1182440093
PLN140 88 789475101
PLN140 30 1163880160
PLN140 20 695066696
PLN140 31 1168031906
PLN140 9 308050326
PLN141 61 342767452
PLN141 25 1164903412
PLN141 4 305227123
PLN141 18 1179459082
PLN141 7 726563806
PLN141 13 1145638388
PLN141 21 341478864
PLN141 37 1181166246
PLN141 11 1086198137
PLN141 4 988846570
PLN141 8 855519588
PLN142 12 1080932099
PLN142 17 1122475859
PLN142 28 577307151
PLN142 1 2143528264
PLN142 1 2138631366
PLN142 1 2132989935
PLN142 1 2142145023
PLN142 1 2142779784
PLN142 1 124381055
PLN142 1 2112395848
PLN142 1 2144481838
PLN143 1 385644068
PLN143 1 2133121580
PLN143 1 2141806609
PLN143 1 1870266305
PLN143 1 2134931027
PLN143 1 2108664250
PLN143 1 2146278775
PLN143 1 2117022170
PLN143 1 1576301307
PLN143 1 2067099338
PLN143 1 2134690998
PLN144 2 884812093
PLN144 1 2136662657
PLN144 1 2140543523
PLN144 1 1531582847
PLN144 1 2146571508
PLN144 1 2138192289
PLN144 1 2101175359
PLN144 1 2146227213
PLN144 1 621086779
PLN144 1 2138605540
PLN144 1 2083688238
PLN145 1 446362846
PLN145 1 2144314009
PLN145 1 2139184679
PLN145 1 172723629
PLN145 1 2132146989
PLN145 1 2133919239
PLN145 1 2133305249
PLN145 1 2100933269
PLN145 1 143347570
PLN145 1 2134142781
PLN145 1 2145201137
PLN146 2 986227910
PLN146 1 2137733646
PLN146 1 1914313492
PLN146 1 2145479601
PLN146 1 2114166385
PLN146 2 3701885723
PLN146 1 2141253099
PLN146 1 2119186544
PLN146 1 2142175433
PLN146 1 1498831827
PLN146 9 1052661862
PLN147 8 726884344
PLN147 2 289205187
PLN147 15 1117991556
PLN147 31 1043827067
PLN147 2 1130183954
PLN147 2 1009393112
PLN147 2 993028308
PLN147 2 1022916012
PLN147 1 567007916
PLN147 2 1019386330
PLN147 3 1015418383
PLN148 26 967428969
PLN148 2 1022027198
PLN148 1 538841055
PLN148 2 982316280
PLN148 2 970455477
PLN148 2 978300218
PLN148 1 519958927
PLN148 2 968690797
PLN148 3 980008249
PLN148 1 448723479
PLN148 2 1145618670
PLN149 2 746994619
PLN149 1 480566411
PLN149 2 943080858
PLN149 2 1000998827
PLN149 2 1157028134
PLN149 1 478334130
PLN149 2 956665786
PLN149 3 1002859015
PLN149 2 1128818178
PLN149 1 507274784
PLN149 2 948335936
PLN15 81 1074115299
PLN150 2 884447165
PLN150 2 879747037
PLN150 2 1127570290
PLN150 1 487585716
PLN150 2 938819340
PLN150 3 885120133
PLN150 1 546259763
PLN150 2 942009307
PLN150 1 491835565
PLN150 2 923497301
PLN150 2 944807908
PLN151 2 918277773
PLN151 2 874182919
PLN151 2 876644296
PLN151 2 959955654
PLN151 2 1006446686
PLN151 2 922850811
PLN151 1 420799321
PLN151 2 930959077
PLN151 2 1041934893
PLN151 2 942999660
PLN151 3 908571112
PLN152 1 513745672
PLN152 2 994915609
PLN152 2 1008745383
PLN152 2 850230395
PLN152 1 470832587
PLN152 2 994476395
PLN152 2 854196926
PLN152 2 912645655
PLN152 2 862849566
PLN152 2 1021576632
PLN152 2 850007440
PLN153 44 1177676547
PLN153 1 367632597
PLN153 2 912116412
PLN153 1 553356059
PLN153 2 966919222
PLN153 2 876261642
PLN153 2 433744592
PLN153 2 997148082
PLN153 1 525597199
PLN153 2 975421395
PLN153 3 998127563
PLN154 21 624683899
PLN154 1 531985519
PLN154 2 997566044
PLN154 1 499943225
PLN154 2 945126499
PLN154 2 977083963
PLN154 2 1036274906
PLN154 1 477529720
PLN154 3 1105984004
PLN154 2 1091311779
PLN154 2 928973494
PLN155 39 1103138744
PLN155 3 547302110
PLN155 2 949186154
PLN155 2 998536841
PLN155 2 803475842
PLN155 2 950330420
PLN155 2 1091972596
PLN155 2 995224407
PLN155 2 973886503
PLN155 1 444660800
PLN155 2 1023553300
PLN156 8 717482648
PLN156 2 914623388
PLN156 2 836746646
PLN156 1 432790581
PLN156 2 1058778957
PLN156 2 930200695
PLN156 1 398551120
PLN156 3 942162386
PLN156 1 488646431
PLN156 2 919820886
PLN156 2 904199719
PLN157 19 1126901545
PLN157 1 469438496
PLN157 2 897026796
PLN157 1 532902629
PLN157 2 948044567
PLN157 2 935988512
PLN157 1 436072789
PLN157 2 1096125550
PLN157 1 474248680
PLN157 2 870794531
PLN157 2 886494923
PLN158 16 912358218
PLN158 2 1089597455
PLN158 1 410174162
PLN158 2 893651928
PLN158 3 567183082
PLN158 16 1151133023
PLN158 7 437975843
PLN158 17 1153565402
PLN158 5 360925906
PLN158 17 1163136190
PLN158 6 446625557
PLN159 66 1141407077
PLN159 17 1119539353
PLN159 5 363333481
PLN159 17 1138413725
PLN159 7 437375609
PLN159 16 1155049463
PLN159 7 448093383
PLN159 14 941595599
PLN159 1 642634776
PLN159 1 827770304
PLN159 1 819590567
PLN16 11 762609320
PLN160 14 530754150
PLN160 1 657919172
PLN160 1 735222392
PLN160 1 640551262
PLN160 2 850883630
PLN160 1 641523445
PLN160 1 830702509
PLN160 1 817725293
PLN160 1 657518596
PLN160 1 728079018
PLN160 1 637620844
PLN161 31 1163496004
PLN161 2 841520699
PLN161 2 787615973
PLN161 1 547589534
PLN161 2 929522122
PLN161 2 918166143
PLN161 2 806717380
PLN161 2 940422912
PLN161 1 481399899
PLN161 2 951785915
PLN161 1 437373607
PLN162 7 308663671
PLN162 2 1059882713
PLN162 2 918539616
PLN162 1 395065095
PLN162 2 968208187
PLN162 2 1065368112
PLN162 2 928206292
PLN162 1 420024747
PLN162 4 1088534694
PLN162 2 483181782
PLN162 29 1161715798
PLN163 15 1140209198
PLN163 10 710862444
PLN163 28 1129046251
PLN163 48 399992240
PLN163 30 1163643496
PLN163 10 243332908
PLN163 50 1168577619
PLN163 24 1108652219
PLN163 55 1166738942
PLN163 55 1162954495
PLN163 15 248922058
PLN164 75 1174627475
PLN164 36 1121022866
PLN164 5 495551257
PLN164 41 1178973598
PLN164 52 1171134433
PLN164 7 194512759
PLN164 24 1161318370
PLN164 20 798845768
PLN164 9 453146765
PLN164 2 3545513960
PLN164 1 1499997841
PLN165 4 169296130
PLN165 1 1493209057
PLN165 1 1187610474
PLN165 1 943684407
PLN165 8 1161825966
PLN165 10 678190269
PLN165 60 1123620493
PLN165 35 1103233680
PLN165 46 1169631932
PLN165 11 202846913
PLN165 42 1174046069
PLN166 20 1127669655
PLN166 17 875971355
PLN166 1 495016746
PLN166 1 767071137
PLN166 1 671256291
PLN166 1 670741101
PLN166 1 671191297
PLN166 1 771176557
PLN166 1 643128204
PLN166 1 694350238
PLN166 1 641290954
PLN167 21 367996154
PLN167 2 1174904300
PLN167 1 745638687
PLN167 8 1174732410
PLN167 2 147868549
PLN167 35 1182764044
PLN167 5 172411700
PLN167 15 1137951826
PLN167 5 302966115
PLN167 38 966678693
PLN167 1 276062833
PLN168 61 1159163589
PLN168 4 1030454020
PLN168 3 601928786
PLN168 4 1044647336
PLN168 12 971273463
PLN168 63 1078890326
PLN168 4 954531898
PLN168 3 630967493
PLN168 6 1075986347
PLN168 1 168867087
PLN168 5 1060020447
PLN169 77 196425373
PLN169 2 423892273
PLN169 6 1155659052
PLN169 5 951995263
PLN169 2 455126092
PLN169 5 1006417560
PLN169 2 322368536
PLN169 4 596865443
PLN169 1 956684326
PLN169 1 561974515
PLN169 1 718270646
PLN17 31 1046603804
PLN170 89 1079795203
PLN170 1 682093502
PLN170 1 700447244
PLN170 1 683485999
PLN170 1 723946829
PLN170 1 751391258
PLN170 1 651249186
PLN170 2 1175723351
PLN170 2 1136845382
PLN170 44 1170528899
PLN170 11 210871698
PLN171 12 550367550
PLN171 63 1052524412
PLN171 26 257833892
PLN171 59 1123224500
PLN171 46 1009258039
PLN171 50 1034374597
PLN171 39 1073881614
PLN171 15 186744529
PLN171 55 1086348695
PLN171 9 812247399
PLN171 13 1182713933
PLN172 58 1176452154
PLN172 5 235556068
PLN172 39 1102878562
PLN172 53 765566879
PLN172 102 1172312507
PLN172 33 462172122
PLN172 102 1181635466
PLN172 17 485320651
PLN172 8 996864010
PLN172 2 641905789
PLN172 17 1163882844
PLN173 15 525826380
PLN173 10 553844493
PLN173 8 1153933128
PLN173 16 907583600
PLN173 61 1171051519
PLN173 27 734261416
PLN173 61 1176014371
PLN173 24 731321476
PLN173 13 1180963047
PLN173 5 688244352
PLN173 14 1163113056
PLN174 8 1100763882
PLN174 16 805479925
PLN174 23 1022775770
PLN174 10 746646445
PLN174 16 1011906545
PLN174 245 448432068
PLN174 40 1125687382
PLN174 5 486453666
PLN174 23 1112738148
PLN174 4 375029786
PLN174 31 1102785788
PLN175 12 876120058
PLN175 4 559407571
PLN175 9 1107885867
PLN175 3 273498886
PLN175 3 1111279011
PLN175 21 708892854
PLN175 47 1178969687
PLN175 13 435695631
PLN175 32 1163219703
PLN175 9 481736695
PLN175 41 1041492517
PLN176 125 1128434270
PLN176 1 287096907
PLN176 5 1039220557
PLN176 3 694607117
PLN176 4 1152030337
PLN176 2 397294614
PLN176 4 957321299
PLN176 3 859838924
PLN176 5 1077255878
PLN176 99 544334847
PLN176 31 1179681258
PLN177 10 393899286
PLN177 30 528844453
PLN177 12 160902153
PLN177 1 1074544454
PLN177 1 1022901297
PLN177 1 981102465
PLN177 1 976125608
PLN177 1 917323440
PLN177 1 850457102
PLN177 1 839193984
PLN177 1 817723161
PLN178 37 1155227141
PLN178 1 817139115
PLN178 1 814406492
PLN178 1 772677518
PLN178 1 772908146
PLN178 1 765793897
PLN178 1 761983751
PLN178 1 764473882
PLN178 4 1011158055
PLN178 1 259209822
PLN178 5 1182813098
PLN179 34 484801414
PLN179 5 897307960
PLN179 2 886585446
PLN179 2 777793815
PLN179 3 1024010686
PLN179 2 650713606
PLN179 3 956055548
PLN179 2 625688420
PLN179 4 1160034441
PLN179 14 692512817
PLN179 28 1087663691
PLN18 19763 845851500
PLN180 107 1130194455
PLN180 4 557984954
PLN180 33 1145150704
PLN180 22 640733644
PLN180 108 1180168347
PLN180 13 505654235
PLN180 99940 927730018
PLN180 69609 262233828
PLN181 3 161953713
PLN182 21 1118876111
PLN183 5 301360214
PLN184 45 1150354114
PLN185 41 269396559
PLN186 52 1177599121
PLN187 2 304331422
PLN188 3 968319031
PLN189 1 372789172
PLN19 96584 101383193
PLN190 22 1167044508
PLN191 11 374752144
PLN192 23 1153098306
PLN193 26 1154548503
PLN194 1 35730237
PLN195 46 1154003332
PLN196 33 1110400232
PLN197 35 1182511832
PLN198 22 740099219
PLN199 34 1161530233
PLN2 101394 600277250
PLN20 113438 117622818
PLN200 25 854672730
PLN201 34 1157604427
PLN202 24 825387235
PLN203 35 1172475088
PLN204 12 446630180
PLN205 21 1156899751
PLN206 1 660154351
PLN207 1 785289892
PLN208 1 752191036
PLN209 2 1138634422
PLN21 57311 72144580
PLN210 1 581969875
PLN211 1 742820188
PLN212 1 722258891
PLN213 1 529961705
PLN214 1 696896727
PLN215 1 768317091
PLN216 1 635914663
PLN217 1 873778448
PLN218 1 759363255
PLN219 1 661150927
PLN22 28689 28922869
PLN220 1 822617018
PLN221 1 788135348
PLN222 1 505466611
PLN223 1 723777933
PLN224 5 1107711193
PLN225 7 799409197
PLN226 8 1169179641
PLN227 3 366576483
PLN228 9 1069109235
PLN229 5 734894067
PLN23 3409 722549176
PLN230 8 1084336480
PLN231 5 513878443
PLN232 8 1129219417
PLN233 4 564629152
PLN234 10 1173787899
PLN235 4 564390138
PLN236 184 1183675910
PLN237 74 178161087
PLN238 186 1176225540
PLN239 6 191220784
PLN24 181 156660490
PLN240 59 1159909644
PLN241 2 163031000
PLN242 15 1135793096
PLN243 20 278435519
PLN244 8 1181372921
PLN245 1 151303025
PLN246 10 1177780724
PLN247 79 398094078
PLN248 97 1176077587
PLN249 17 279347376
PLN25 1125 877653193
PLN250 57 1166091260
PLN251 25 648204528
PLN252 45 1157412191
PLN253 25 652391528
PLN254 46 1181233513
PLN255 24 608727265
PLN256 96 1141584077
PLN257 12 677643950
PLN258 30 1173673238
PLN259 36 251740737
PLN26 109 78230336
PLN260 37 16871
PLN261 149 79314
PLN262 2469 93786416
PLN263 7181 18795412
PLN264 14346 29953091
PLN265 227168 299417720
PLN266 379449 326289045
PLN267 273014 666371542
PLN268 72045 110649218
PLN269 98644 85504671
PLN27 690 1012117390
PLN270 49729 72847341
PLN271 25060 110564695
PLN272 21867 892692548
PLN273 1872 1106451307
PLN274 8 500798893
PLN275 513 1049508159
PLN276 1 474651383
PLN277 1 612216829
PLN278 1 571018318
PLN279 2 1112570752
PLN28 371 1062942605
PLN280 130 1162682290
PLN281 13681 570195101
PLN282 198960 140043975
PLN283 384628 373797445
PLN284 343659 278663230
PLN285 274523 291240160
PLN286 283673 242536621
PLN287 237398 271582332
PLN288 382368 479070207
PLN289 21556 19743565
PLN29 255 1101294268
PLN290 323192 495925512
PLN291 287376 592558905
PLN292 23112 420811084
PLN293 30271 986119976
PLN294 3295 696602499
PLN295 1392 566152517
PLN296 1283 755100775
PLN297 1 675310294
PLN298 1 628753756
PLN299 1 624247919
PLN3 197597 419771519
PLN30 29 802880115
PLN300 2 1172266179
PLN301 8564 784313867
PLN302 1 727344967
PLN303 1 946003158
PLN304 1 965754312
PLN305 1 906459801
PLN306 1 876148008
PLN307 1 885153844
PLN308 1 899925126
PLN309 4163 1100106582
PLN31 118 1157726217
PLN310 8 255456585
PLN311 543 1092756245
PLN312 129 281783689
PLN313 206 92200731
PLN314 64 1045685747
PLN315 1 696809892
PLN316 1 655542733
PLN317 1 648987779
PLN318 1 622068216
PLN319 1 583456046
PLN32 73 555012493
PLN320 132 1176770373
PLN321 1 675310294
PLN322 1 628753756
PLN323 1 624247919
PLN324 2 1172266179
PLN325 345 729691402
PLN326 1 521073757
PLN327 1 672273650
PLN328 1 634137895
PLN329 1 624121443
PLN33 74 124609184
PLN330 2 1171800569
PLN331 2 1153005584
PLN332 1 661076038
PLN333 1 626572591
PLN334 1 612852138
PLN335 2 1169525711
PLN336 2 1136827172
PLN337 1 653624577
PLN338 1 616219606
PLN339 1 610044819
PLN34 15 1076501108
PLN340 2 1134152592
PLN341 2 1156707404
PLN342 1 685423969
PLN343 1 640667275
PLN344 1 639123876
PLN345 1 612949391
PLN346 1 577192767
PLN347 1 641629864
PLN348 2 1148934912
PLN349 1 604770208
PLN35 3 422359550
PLN350 2 1173859433
PLN351 1 556080982
PLN352 2 1115335392
PLN353 1 652551272
PLN354 1 615767531
PLN355 1 605571303
PLN356 1 592249714
PLN357 4 1166268162
PLN358 1 550024188
PLN359 1 710194481
PLN36 49 1134143683
PLN360 1 661081403
PLN361 1 659460550
PLN362 1 630572514
PLN363 1 598618390
PLN364 1 658974642
PLN365 1 559656399
PLN366 1 717517502
PLN367 1 672450454
PLN368 1 665297378
PLN369 1 636785599
PLN37 31 548900587
PLN370 1 599706080
PLN371 1 675658265
PLN372 1 523168208
PLN373 1 671211297
PLN374 1 630677708
PLN375 1 623428415
PLN376 1 604298040
PLN377 1 558526623
PLN378 2 1124081839
PLN379 1 640830439
PLN38 21 1180521825
PLN380 1 597781253
PLN381 1 600363860
PLN382 2 1105176863
PLN383 2 1154056276
PLN384 1 685947972
PLN385 1 649921694
PLN386 1 641099225
PLN387 1 611845738
PLN388 1 581041262
PLN389 2 1176958498
PLN39 47 381546474
PLN390 1 667717957
PLN391 1 631819663
PLN392 1 624692602
PLN393 1 597351075
PLN394 1 561737938
PLN395 2 1154165677
PLN396 1 670202054
PLN397 1 631946783
PLN398 1 626743494
PLN399 2 1167772850
PLN4 54154 448569398
PLN40 159 1056502701
PLN400 2 1151941538
PLN401 1 671530377
PLN402 1 631910401
PLN403 1 622474059
PLN404 2 1160377439
PLN405 2 1159528938
PLN406 1 684336246
PLN407 1 636053469
PLN408 1 629969872
PLN409 2 1172688001
PLN41 125 832265940
PLN410 2 1160045407
PLN411 1 665715246
PLN412 1 624683667
PLN413 1 621078253
PLN414 2 1159864294
PLN415 2 1170185454
PLN416 1 697540743
PLN417 1 655862368
PLN418 1 646765634
PLN419 1 618540729
PLN42 213 995602210
PLN420 1 587963859
PLN421 455 1147653963
PLN422 10 201809768
PLN423 21 707743781
PLN424 1 705338699
PLN425 1 493450010
PLN426 1 804285258
PLN427 1 810734643
PLN428 1 673981989
PLN429 1 754496630
PLN43 32 996843807
PLN430 1 855759449
PLN431 1 614042580
PLN432 1 743847818
PLN433 1 673340788
PLN434 1 515668560
PLN435 1 713320806
PLN436 1 703598484
PLN437 1 570159854
PLN438 1 625793224
PLN439 1 721110502
PLN44 73 639978110
PLN440 1 459355444
PLN441 1 745201001
PLN442 1 749284433
PLN443 1 643344672
PLN444 1 595297365
PLN445 1 688905267
PLN446 1 491807393
PLN447 1 769338634
PLN448 1 671568023
PLN449 1 635285330
PLN45 4 991306162
PLN450 1 745618965
PLN451 1 839470345
PLN452 1 646400022
PLN453 1 747589525
PLN454 2 1171764895
PLN455 1 703962928
PLN456 1 702438406
PLN457 2 1178978634
PLN458 2 1173154747
PLN459 1 734536914
PLN46 1 296818136
PLN460 1 738743901
PLN461 1 636778132
PLN462 1 602900890
PLN463 1 697493198
PLN464 1 490518203
PLN465 1 784661008
PLN466 1 810500911
PLN467 1 655314739
PLN468 1 752710991
PLN469 1 890847171
PLN47 5 1159558460
PLN470 1 621781073
PLN471 1 743084022
PLN472 1 676741658
PLN473 1 509452426
PLN474 1 710124532
PLN475 2 1058788934
PLN476 1 620140791
PLN477 1 716573881
PLN478 1 476726550
PLN479 1 756324664
PLN48 56 233110334
PLN480 1 977471539
PLN481 2 1144819353
PLN482 1 646234737
PLN483 1 605172934
PLN484 1 593744788
PLN485 2 1117445025
PLN486 1 607667504
PLN487 1 590561804
PLN488 2 1176631761
PLN489 1 782694893
PLN49 21 1168726770
PLN490 1 796420183
PLN491 1 650274702
PLN492 1 739889549
PLN493 1 848590828
PLN494 1 610626473
PLN495 1 738023571
PLN496 2 1173882462
PLN497 1 701434008
PLN498 1 690770133
PLN499 1 567265955
PLN5 32073 942678547
PLN50 1 157681923
PLN500 1 612987783
PLN501 1 704156067
PLN502 1 475327881
PLN503 1 732118298
PLN504 1 733931846
PLN505 1 636796232
PLN506 1 599764323
PLN507 1 691313424
PLN508 1 493357854
PLN509 1 782685093
PLN51 184 1170332002
PLN510 1 786410271
PLN511 1 648139033
PLN512 1 744407562
PLN513 1 835583350
PLN514 1 623221719
PLN515 1 741299132
PLN516 1 669032550
PLN517 1 517040482
PLN518 1 711661679
PLN519 1 708205786
PLN52 52 491981677
PLN520 2 1156892395
PLN521 2 1178356817
PLN522 1 737453356
PLN523 1 736349413
PLN524 1 639162162
PLN525 1 586755746
PLN526 1 704478343
PLN527 1 492109999
PLN528 1 791475352
PLN529 1 785940626
PLN53 8 1074474850
PLN530 1 661246824
PLN531 1 756990402
PLN532 1 858776195
PLN533 1 621195942
PLN534 1 754256086
PLN535 1 670301833
PLN536 1 509263899
PLN537 1 708234589
PLN538 1 725120110
PLN539 1 575129590
PLN54 48 777884683
PLN540 1 620883766
PLN541 1 727285804
PLN542 1 479660269
PLN543 1 745978486
PLN544 1 750160716
PLN545 1 642428577
PLN546 1 591313643
PLN547 1 705330581
PLN548 1 495656580
PLN549 1 803232604
PLN55 76 1120919626
PLN550 1 790745243
PLN551 1 657494025
PLN552 1 759305888
PLN553 1 856542542
PLN554 1 628321883
PLN555 1 754364263
PLN556 1 697113365
PLN557 1 504254270
PLN558 1 715354979
PLN559 1 713929667
PLN56 18 645106926
PLN560 1 572943128
PLN561 1 626959190
PLN562 1 715714221
PLN563 1 483823121
PLN564 1 742917797
PLN565 1 748536659
PLN566 1 643784981
PLN567 1 600654286
PLN568 2 1171400808
PLN569 1 794150360
PLN57 337 1002760898
PLN570 1 799857935
PLN571 1 655329108
PLN572 1 749763888
PLN573 1 838116175
PLN574 1 610468321
PLN575 1 736551279
PLN576 2 1171154657
PLN577 2 1170482349
PLN578 1 566465558
PLN579 1 614421429
PLN58 121 251819355
PLN580 2 1179310235
PLN581 1 735408736
PLN582 1 969998116
PLN583 11 635028102
PLN584 1 595339094
PLN585 1 698605642
PLN586 1 499102108
PLN587 1 791748890
PLN588 1 797311483
PLN589 1 656817438
PLN59 433 1050481664
PLN590 1 753360318
PLN591 1 845838138
PLN592 1 619661694
PLN593 1 752772853
PLN594 1 689709469
PLN595 1 509595892
PLN596 1 712797596
PLN597 1 710493282
PLN598 1 570643040
PLN599 1 619886155
PLN6 46 124218893
PLN60 99 698308529
PLN600 1 705533140
PLN601 1 484551304
PLN602 1 740148362
PLN603 1 757233630
PLN604 1 642499559
PLN605 1 594006513
PLN606 1 693261537
PLN607 1 492948387
PLN608 1 781462734
PLN609 1 802944975
PLN61 430 1173128636
PLN610 1 650275864
PLN611 1 756841830
PLN612 1 850623622
PLN613 1 614136911
PLN614 1 723255126
PLN615 2 1177410070
PLN616 1 712168462
PLN617 1 712339524
PLN618 1 564869106
PLN619 1 619418949
PLN62 127 437592776
PLN620 1 715454519
PLN621 1 478264344
PLN622 1 734693445
PLN623 1 749685439
PLN624 1 633598967
PLN625 1 782818162
PLN626 1 1022071454
PLN627 1 971920087
PLN628 1 827198496
PLN629 1 867619200
PLN63 105 1134076865
PLN630 1 806566123
PLN631 1 1015700474
PLN632 1 742303966
PLN633 1 956173857
PLN634 1 916702776
PLN635 1 874517040
PLN636 1 816294110
PLN637 1 750216944
PLN638 21 862613184
PLN639 176 657269103
PLN64 111 220031698
PLN640 1 665585731
PLN641 1 621516506
PLN642 1 610333535
PLN643 2 1150013201
PLN644 119 632628552
PLN645 4 1055123987
PLN646 2 399259151
PLN647 773 1136041142
PLN648 18 958385885
PLN649 3 1008669690
PLN65 263 1054918164
PLN650 16454 1068645461
PLN651 5636 1862075
PLN652 7252 957026037
PLN653 1 594102056
PLN654 1 689851870
PLN655 1 495453186
PLN656 1 780798557
PLN657 1 801256715
PLN658 1 651852609
PLN659 1 750843639
PLN66 366 849444238
PLN660 1 830829764
PLN661 1 615552423
PLN662 1 744588157
PLN663 1 673617499
PLN664 1 509857067
PLN665 1 709773743
PLN666 1 713149757
PLN667 1 566080677
PLN668 1 618079260
PLN669 1 720988478
PLN67 172 1104865850
PLN670 1 473592718
PLN671 1 736706236
PLN672 1 750620385
PLN673 2578 1146365542
PLN674 4108 303878996
PLN675 15611 709441102
PLN676 1 585266722
PLN677 1 681112512
PLN678 1 775448786
PLN679 1 790338525
PLN68 16 282568200
PLN680 1 746673839
PLN681 1 836514780
PLN682 1 736872137
PLN683 1 676292951
PLN684 1 669155517
PLN685 1 701372996
PLN686 1 615672275
PLN687 1 698614761
PLN688 1 728031845
PLN689 12303 731451465
PLN69 224 1167597370
PLN690 94681 142561029
PLN691 280498 582157558
PLN692 302403 570752431
PLN693 15830 37742810
PLN694 246076 636621994
PLN695 45692 143551603
PLN696 201276 690374241
PLN697 2873 16285478
PLN698 160619 731661414
PLN699 28304 89241107
PLN7 4357 1078154010
PLN70 96 448470916
PLN700 166193 727892101
PLN701 128489 590591519
PLN702 169651 731041671
PLN703 55445 199604311
PLN704 133181 783260298
PLN705 55200 319311898
PLN706 198145 714816640
PLN707 38857 225085400
PLN708 168901 733663532
PLN709 30661 760310714
PLN71 10 1182999913
PLN710 1 528447123
PLN711 1 678170541
PLN712 1 639558213
PLN713 1 629672760
PLN714 1 608467472
PLN715 1 565695744
PLN716 2 1166970321
PLN717 1 684376481
PLN718 1 642597466
PLN719 1 631979072
PLN72 9 1033145339
PLN720 1 607115911
PLN721 1 582960187
PLN722 1 640026769
PLN723 1 608979116
PLN724 1 720972993
PLN725 1 501257520
PLN726 1 804602427
PLN727 1 808121247
PLN728 1 649118519
PLN729 1 758906661
PLN73 9 1070832115
PLN730 1 861141126
PLN731 1 642382296
PLN732 1 759893476
PLN733 1 689766370
PLN734 1 531462149
PLN735 1 714517032
PLN736 1 717288350
PLN737 1 586345039
PLN738 1 626266972
PLN739 1 738085275
PLN74 10 1167983468
PLN740 1 505809789
PLN741 1 759124079
PLN742 1 751612808
PLN743 12 1160338339
PLN744 685 1037884752
PLN745 2 1145861525
PLN746 2 1112884977
PLN747 1 477706438
PLN748 2 875660940
PLN749 2 924439243
PLN75 6 1041755176
PLN750 1 481348281
PLN751 2 896921305
PLN752 2 995026189
PLN753 2 869378871
PLN754 2 922541915
PLN755 2 917029648
PLN756 1 538887009
PLN757 1 574640544
PLN758 1 667652801
PLN759 2 1153333809
PLN76 2 356433379
PLN760 2 976557482
PLN761 2 971318115
PLN762 2 905021021
PLN763 2 779060037
PLN764 2 1026993414
PLN765 2 1040398764
PLN766 2 906287378
PLN767 2 1107801300
PLN768 2 1085890887
PLN769 1 588203704
PLN77 63 1173046176
PLN770 2 1015273266
PLN771 2 965280586
PLN772 1 582703961
PLN773 2 1026383973
PLN774 2 1018992133
PLN775 20 537195591
PLN776 1 613662638
PLN777 1 794474755
PLN778 1 760111594
PLN779 1 769810128
PLN78 182 756898379
PLN780 1 715684684
PLN781 1 623890083
PLN782 1 755457679
PLN783 1 717109572
PLN784 1 817712742
PLN785 1 864624966
PLN786 1 701857263
PLN787 1 726425509
PLN788 1 738041677
PLN789 1 767912069
PLN79 117 1159004230
PLN790 1 504659958
PLN791 1 662526948
PLN792 2 1167934623
PLN793 2 1091547167
PLN794 3 1082389428
PLN795 2 582533673
PLN796 3 942215135
PLN797 1 354403191
PLN798 316 1102146609
PLN799 37 1037827543
PLN8 77 711343148
PLN80 12 1141850928
PLN800 74 199331596
PLN801 436 1166298862
PLN802 26 992712695
PLN803 4 1158055928
PLN804 2 1135086767
PLN805 2 1031765593
PLN806 149 1154467731
PLN807 23 858680371
PLN808 1053 1144769269
PLN809 1 703076930
PLN81 5 1125968574
PLN810 1 495911329
PLN811 1 796169439
PLN812 1 779372321
PLN813 1 665561653
PLN814 1 757165295
PLN815 1 852704148
PLN816 1 623698249
PLN817 1 745048881
PLN818 1 677947850
PLN819 1 524289323
PLN82 2 359637190
PLN820 1 726838826
PLN821 1 701430346
PLN822 1 584133940
PLN823 1 622677745
PLN824 1 745712656
PLN825 1 490622797
PLN826 1 748850018
PLN827 1 753856519
PLN828 700 674126380
PLN829 1 593930347
PLN83 283 1034403005
PLN830 1 702775664
PLN831 1 494594617
PLN832 1 792837209
PLN833 1 812232696
PLN834 1 661835603
PLN835 1 750337041
PLN836 1 854463248
PLN837 1 623248023
PLN838 1 749950614
PLN839 1 673746810
PLN84 40 1075820283
PLN840 1 520815567
PLN841 1 712547961
PLN842 1 703299309
PLN843 1 569771178
PLN844 1 620176429
PLN845 1 717542863
PLN846 1 493761083
PLN847 1 746502734
PLN848 1 752612656
PLN849 573 686952725
PLN85 3 424655429
PLN850 2 990024350
PLN851 2 888868060
PLN852 1 485323027
PLN853 2 941973305
PLN854 2 1051914856
PLN855 1 638425132
PLN856 1 716105986
PLN857 1 613160974
PLN858 2 1177939381
PLN859 2 1016319037
PLN86 8 1102481801
PLN860 1 480949782
PLN861 2 954568201
PLN862 1 298028472
PLN863 242 1168816031
PLN864 310 746899521
PLN865 133 749981360
PLN866 1 702775664
PLN867 1 494594617
PLN868 1 792837209
PLN869 1 812232696
PLN87 2 540692104
PLN870 1 661835603
PLN871 1 750337041
PLN872 1 854463248
PLN873 1 623248023
PLN874 1 749950614
PLN875 1 673746810
PLN876 1 520815567
PLN877 1 712547961
PLN878 1 703299309
PLN879 1 569771178
PLN88 4 991095321
PLN880 1 620176429
PLN881 1 717542863
PLN882 1 493761083
PLN883 1 746502734
PLN884 1 752612656
PLN885 233 1180834457
PLN886 6503 509584943
PLN887 1 657893865
PLN888 2 1156686622
PLN889 2 1150914040
PLN89 2 509157458
PLN890 5 626957076
PLN891 103 1176215683
PLN892 32 874057681
PLN893 59 1170613979
PLN894 37 890565897
PLN895 42 1157660304
PLN896 33 916538999
PLN897 38 1124061822
PLN898 19 958397564
PLN899 35 1145742472
PLN9 32 1155338215
PLN90 23 1166540265
PLN900 11 421835350
PLN901 39 1163413684
PLN902 1573 930234770
PLN903 10 1112532336
PLN904 120 1115935246
PLN905 5 402339329
PLN906 21 1180552620
PLN907 8 416782388
PLN908 279 1134361485
PLN909 9 315307783
PLN91 259 1173013079
PLN910 4 1080552710
PLN911 2 438380923
PLN912 43 1145344578
PLN913 13 1126392473
PLN914 119 245112629
PLN915 23 1093148685
PLN916 5 422767247
PLN917 24 1165880814
PLN918 189 569374133
PLN919 1 599230268
PLN92 3 110045716
PLN920 1 709345803
PLN921 1 499575344
PLN922 1 795989443
PLN923 1 809120074
PLN924 1 670531570
PLN925 1 759055895
PLN926 1 872909281
PLN927 1 637083831
PLN928 1 765902670
PLN929 1 688536368
PLN93 17 900773506
PLN930 1 533804092
PLN931 1 714878730
PLN932 1 728610199
PLN933 1 586077705
PLN934 1 622419581
PLN935 1 733835468
PLN936 1 506756789
PLN937 1 759450946
PLN938 1 768174826
PLN939 3 659068422
PLN94 1 594546470
PLN940 1 865431811
PLN941 1 841368522
PLN942 1 772393794
PLN943 1 766078222
PLN944 1 735900830
PLN945 1 693266847
PLN946 1 690056233
PLN947 1 654671025
PLN948 1 681539918
PLN949 1 650134427
PLN95 2 1174734371
PLN950 1 643737533
PLN951 2 1092839925
PLN952 1 528421643
PLN953 2 1025960110
PLN954 1 484156440
PLN955 13 427663120
PLN956 1 1574527093
PLN957 1 1805244829
PLN958 1 1716769615
PLN959 1 1637815978
PLN96 2 1111268940
PLN960 1 1645877737
PLN961 1 1365994436
PLN962 1 1520236431
PLN963 8 34567157
PLN964 13 790727573
PLN965 1 660114068
PLN966 1 623862790
PLN967 1 606413785
PLN968 2 1155915948
PLN969 1 627107635
PLN97 28 1135832320
PLN970 2 1184046427
PLN971 1 626943711
PLN972 1 613583204
PLN973 1 592677528
PLN974 1 559914542
PLN975 2 1147808788
PLN976 1 656479363
PLN977 1 621609376
PLN978 1 611088072
PLN979 2 1140013277
PLN98 19 506053923
PLN980 2 1154214120
PLN981 1 661498744
PLN982 1 626053568
PLN983 1 608346219
PLN984 2 1151823422
PLN985 1 639402856
PLN986 1 523218450
PLN987 1 661546608
PLN988 1 633922074
PLN989 1 612932250
PLN99 25 1176429757
PLN990 1 591516528
PLN991 2 1182689651
PLN992 1 530821096
PLN993 1 664715623
PLN994 1 631770265
PLN995 1 613234972
PLN996 1 604325310
PLN997 1 582152544
PLN998 2 1158575799
PLN999 1 661621317
PRI1 23047 60053106
PRI10 2242 1049737833
PRI11 7 1054721751
PRI12 9619 1167759726
PRI13 51713 80725821
PRI14 53151 979836358
PRI15 9 1175135830
PRI16 5 991549712
PRI17 7 910099045
PRI18 6 1153842105
PRI19 11 1048070247
PRI2 28864 1050341494
PRI20 8 1079970482
PRI21 7 985425133
PRI22 10 1151503273
PRI23 11 1110746409
PRI24 2 278974018
PRI25 7 1151013097
PRI26 127671 939740267
PRI27 52008 101670651
PRI28 163401 559900232
PRI29 169439 643144896
PRI3 4703 636595787
PRI30 107949 842809890
PRI31 11829 60188380
PRI32 117987 873821391
PRI33 169 429127848
PRI34 772 1171021624
PRI35 60728 822942865
PRI4 8333 1104652402
PRI5 8708 961605218
PRI6 19803 634234652
PRI7 27929 79132073
PRI8 96050 166265556
PRI9 30070 1101152567
ROD1 42159 1008837853
ROD10 12 1077235365
ROD100 6 568551949
ROD101 13 1057276660
ROD102 3 482785390
ROD103 11 1120709301
ROD104 11 954882810
ROD105 11 1138251811
ROD106 17 1102190201
ROD107 7 1067152563
ROD108 6 668123932
ROD109 16 1131848017
ROD11 4 763441177
ROD110 7 689992124
ROD111 19 1156972737
ROD112 5 609164690
ROD113 13 1146902586
ROD114 13 706688834
ROD115 11 1146173548
ROD116 148 1098231299
ROD117 1 200613070
ROD118 7 1092870110
ROD119 13 1146606716
ROD12 8 1167428371
ROD120 5 164633524
ROD121 6 1061461004
ROD122 2 290810599
ROD123 9 1128512114
ROD124 3 380669787
ROD125 7 1130203367
ROD126 9 1155091067
ROD127 3 341681182
ROD128 4 1011986517
ROD129 3 508379433
ROD13 161 918978924
ROD130 9 1171322624
ROD131 28203 287652639
ROD14 7 1078339014
ROD15 5 617359317
ROD16 89 1130749860
ROD17 5 531191793
ROD18 15 1161179778
ROD19 7 553671745
ROD2 4239 782462163
ROD20 19 1172805098
ROD21 98518 628057562
ROD22 8 1096445171
ROD23 11 1065805777
ROD24 8 1087503260
ROD25 10 859668626
ROD26 7 1065740602
ROD27 110 1130872454
ROD28 10 1095487923
ROD29 4 611448462
ROD3 5925 1106303123
ROD30 9 1170792484
ROD31 7 1007233338
ROD32 12 1139805638
ROD33 7 1102147628
ROD34 10 1155930739
ROD35 11 1098049524
ROD36 9 1150323287
ROD37 9 1170918579
ROD38 9 1178699347
ROD39 10 1042031390
ROD4 16388 354458066
ROD40 2 334811729
ROD41 8 1108112131
ROD42 11 1166769479
ROD43 1 157584965
ROD44 8 1106421483
ROD45 11 1096468690
ROD46 2 245275529
ROD47 10 1105189242
ROD48 9 1153800168
ROD49 1 177680146
ROD5 23215 505710838
ROD50 8 1124775391
ROD51 11 1014425308
ROD52 2 370341452
ROD53 8 1135703989
ROD54 6 684815851
ROD55 10 1148623723
ROD56 5 671349488
ROD57 11 1011717511
ROD58 5 821705591
ROD59 9 1145859896
ROD6 303406 646145155
ROD60 8 740870690
ROD61 7 1083840393
ROD62 10 1142364021
ROD63 3 146446812
ROD64 10 1150647282
ROD65 8 1094459808
ROD66 3 269228856
ROD67 10 1152930414
ROD68 4 578343561
ROD69 19 1066268739
ROD7 97482 65746136
ROD70 8 876855184
ROD71 19 1151436343
ROD72 6 649442391
ROD73 12 1119919372
ROD74 21 1026661546
ROD75 1 188060799
ROD76 8 1175090281
ROD77 7 697432909
ROD78 12 1037257517
ROD79 6 916476668
ROD8 40631 989070813
ROD80 10 1136813612
ROD81 6 757758797
ROD82 8 1083186456
ROD83 10 1065713492
ROD84 1 184589612
ROD85 7 1082392531
ROD86 9 1050453265
ROD87 9 1140334745
ROD88 11 1018693748
ROD89 10 1099288471
ROD9 5 747888891
ROD90 8 967904117
ROD91 13 1050156797
ROD92 9 1142937325
ROD93 14 1036322534
ROD94 6 975869499
ROD95 13 1164045684
ROD96 9 1064632113
ROD97 11 1130583323
ROD98 8 525643352
ROD99 7 1113949024
STS1 322255 155037062
STS2 325270 215137713
STS3 330216 149930483
STS4 369247 120817879
SYN1 54450 995654191
SYN10 135733 848278153
SYN11 56349 405683512
SYN2 5 418163749
SYN3 7 1026747849
SYN4 7 905174914
SYN5 9 1164048999
SYN6 7 771284004
SYN7 6 1076407027
SYN8 333 913831861
SYN9 66433 277114560
TSA1 530474 190965098
TSA10 107955 75847634
TSA11 421728 180662797
TSA12 453722 281751974
TSA13 496775 439245490
TSA14 151611 162821539
TSA15 478101 442403965
TSA16 69555 96695981
TSA17 540330 380298629
TSA18 75992 43161511
TSA19 472069 354771593
TSA2 431253 271169054
TSA20 472700 346803005
TSA21 485077 345824164
TSA22 447500 371642457
TSA23 137157 81320982
TSA24 511078 439646845
TSA25 58840 96630961
TSA26 386750 404742785
TSA27 386747 295816167
TSA28 515188 355802485
TSA29 41717 39146972
TSA3 450976 244523399
TSA30 402182 380481762
TSA31 1332 456025
TSA32 350087 279521147
TSA33 350088 306834608
TSA34 506159 408010496
TSA35 176936 190058946
TSA36 519423 404484025
TSA37 32591 22930116
TSA38 309272 251629584
TSA39 263445 683524151
TSA4 423423 363034342
TSA40 30090 107284106
TSA41 321401 286606614
TSA42 33866 32890162
TSA43 225626 184706695
TSA44 67909 19803915
TSA45 252490 65705875
TSA46 134255 46673193
TSA47 386745 358263417
TSA48 400786 529016441
TSA49 111964 240609423
TSA5 391580 314616150
TSA50 391566 529635074
TSA51 121185 168266178
TSA52 431861 456395607
TSA53 94591 61299880
TSA54 451898 419220916
TSA55 123499 121448278
TSA6 443854 278464186
TSA7 576449 352192162
TSA8 23841 14335953
TSA9 545119 359475407
UNA1 775 4564014
VRL1 351164 457376774
VRL10 238615 459120038
VRL100 26044 663939957
VRL101 11626 345235602
VRL102 22860 665086056
VRL103 11858 343538398
VRL104 23413 665701550
VRL105 10928 324701294
VRL106 23119 666015001
VRL107 11606 339734423
VRL108 23789 665031434
VRL109 11350 338299608
VRL11 216563 446868739
VRL110 23448 664409576
VRL111 11575 339039157
VRL112 23149 661332617
VRL113 2048 61046862
VRL114 26122 664160460
VRL115 2174 64764995
VRL116 22327 664086068
VRL117 23317 666255776
VRL118 3659 109050930
VRL119 23180 665172380
VRL12 201689 666385139
VRL120 11590 335046137
VRL121 23008 664679711
VRL122 12228 338832059
VRL123 22591 664270966
VRL124 13692 405909769
VRL125 22387 665914600
VRL126 2482 73993039
VRL127 22703 667381501
VRL128 3394 101172342
VRL129 22628 661840989
VRL13 66283 157270509
VRL130 4656 137549576
VRL131 22904 673803092
VRL132 4083 119637084
VRL133 22879 662991979
VRL134 5551 165320293
VRL135 23148 664999694
VRL136 5819 171775000
VRL137 22759 668615839
VRL138 7869 232190750
VRL139 22871 663327809
VRL14 212107 526211723
VRL140 4238 120052508
VRL141 28861 669032717
VRL142 3746 111460380
VRL143 22891 664361220
VRL144 2509 73351678
VRL145 24609 664191109
VRL146 9765 251452110
VRL147 22702 660801592
VRL148 7250 203163134
VRL149 36328 650622377
VRL15 231927 511128498
VRL150 7719 221201008
VRL151 22388 661482637
VRL152 13163 287131435
VRL153 24412 662422103
VRL154 3082 83056403
VRL155 22771 661222738
VRL156 6828 200274547
VRL157 22489 661890907
VRL158 3424 98648510
VRL159 22671 664240162
VRL16 192668 552914006
VRL160 5495 160014237
VRL161 22762 662463834
VRL162 10496 288267786
VRL163 24386 659952216
VRL164 7386 219192736
VRL165 23092 661622542
VRL166 7565 220521556
VRL167 25220 662310155
VRL168 4939 123779990
VRL169 23251 663395448
VRL17 21441 139529222
VRL170 4539 115826637
VRL171 24300 663419155
VRL172 3563 104712982
VRL173 25788 661101279
VRL174 4589 133546685
VRL175 24491 669736945
VRL176 3674 98938219
VRL177 24351 665637579
VRL178 2685 72430400
VRL179 24069 667426005
VRL18 73874 644022198
VRL180 3512 103654952
VRL181 24667 666306851
VRL182 6944 203160225
VRL183 23811 668014275
VRL184 6812 184506286
VRL185 23296 668363688
VRL186 2852 84712584
VRL187 24187 665094210
VRL188 3922 107724361
VRL189 23339 665176538
VRL19 11500 129260603
VRL190 3280 93669315
VRL191 27330 659200052
VRL192 6944 178729503
VRL193 23992 667076935
VRL194 4728 132417861
VRL195 22723 661214812
VRL196 5850 167602381
VRL197 27182 660103618
VRL198 9720 274841774
VRL199 24051 670232794
VRL2 23189 398305954
VRL20 61362 650037758
VRL200 3172 93782526
VRL201 23530 664001771
VRL202 23608 623469228
VRL203 25193 666754935
VRL204 4549 123588514
VRL205 24883 661180853
VRL206 2493 74114147
VRL207 25599 664124916
VRL208 6270 169740489
VRL209 25812 667648806
VRL21 10667 157069793
VRL210 14257 347292947
VRL211 26412 664860050
VRL212 4115 122105870
VRL213 23860 668910998
VRL214 5349 151023670
VRL215 26323 660701067
VRL216 4632 125077545
VRL217 26501 661145227
VRL218 6442 126488824
VRL219 27199 658259474
VRL22 35249 659745762
VRL220 7399 202892000
VRL221 23997 663152115
VRL222 8467 205721477
VRL223 25489 664368315
VRL224 23093 665513897
VRL225 3588 105599670
VRL226 30164 663766665
VRL227 12573 337105674
VRL228 23987 665681145
VRL229 4163 123851428
VRL23 5845 129302223
VRL230 23546 669066689
VRL231 2557 86055576
VRL232 24310 666823566
VRL233 3764 99778178
VRL234 24996 667498705
VRL235 2799 110004708
VRL236 23811 670211616
VRL237 13151 374757527
VRL238 29250 657954104
VRL239 18576 368689307
VRL24 27312 665721536
VRL240 26811 667881767
VRL241 16525 414506548
VRL242 31781 659141754
VRL243 5331 139241702
VRL244 25384 668647837
VRL245 5839 157123144
VRL246 31754 660389974
VRL247 11959 304495376
VRL248 25992 659732017
VRL249 3388 100932101
VRL25 13884 308196854
VRL250 24200 666445811
VRL251 6061 138797003
VRL252 29137 660986335
VRL253 3542 98178735
VRL254 35952 652258788
VRL255 5389 89606528
VRL256 24821 665712552
VRL257 2716 76867684
VRL258 28058 662477137
VRL259 3172 94020244
VRL26 32776 659460329
VRL260 27513 669104309
VRL261 2235 145523241
VRL262 24834 673521600
VRL263 7665 169214837
VRL264 25324 664507781
VRL265 3146 88780507
VRL266 41059 653694494
VRL267 10251 186570090
VRL268 32624 666361509
VRL269 16826 225289123
VRL27 14107 301524080
VRL270 26022 667143254
VRL271 2842 83928530
VRL272 46832 656179641
VRL273 11986 182225371
VRL274 33441 672836262
VRL275 11554 258329781
VRL276 34538 667329053
VRL277 11436 271777429
VRL278 22343 665927919
VRL279 2213 63674476
VRL28 24771 661733446
VRL280 37648 665147933
VRL281 6521 105421912
VRL282 28356 664946837
VRL283 4219 88293054
VRL284 36909 660316198
VRL285 2826 71210798
VRL286 38925 663487075
VRL287 6610 95278131
VRL288 27482 666989860
VRL289 14161 315014695
VRL29 20908 281282381
VRL290 12227 365289108
VRL291 18622 556401819
VRL292 1904 56895892
VRL293 37600 1122562705
VRL294 6408 191001999
VRL295 38039 1133916160
VRL296 7081 211211275
VRL297 37759 1126417186
VRL298 4393 131120156
VRL299 37573 1121004282
VRL3 271538 434737633
VRL30 23746 661358862
VRL300 3678 109876644
VRL301 37263 1113069284
VRL302 6459 192949404
VRL303 37152 1110095569
VRL304 3508 104849697
VRL305 37050 1109816359
VRL306 2971 88793839
VRL307 3626 108345075
VRL308 37059 1106189870
VRL309 3080 92054761
VRL31 6587 182464490
VRL310 37003 1105752003
VRL311 11640 347894626
VRL312 37117 1107776127
VRL313 3565 106560617
VRL314 37101 1107706020
VRL315 8906 266186263
VRL316 37266 1112961387
VRL317 19262 575377200
VRL318 37096 1108446363
VRL319 13825 412904674
VRL32 24944 660257977
VRL320 36984 1105279601
VRL321 9990 298572291
VRL322 37050 1107279362
VRL323 8845 264320349
VRL324 37064 1107692833
VRL325 6116 182789958
VRL326 36189 1081600686
VRL327 7777 232438502
VRL328 36975 1104659436
VRL329 7120 212797569
VRL33 6094 160643526
VRL330 36968 1104523842
VRL331 7152 213351330
VRL332 37490 1118859789
VRL333 7207 215280046
VRL334 37076 1107334502
VRL335 7143 213477342
VRL336 37102 1107707586
VRL337 6910 206517986
VRL338 36982 1105546560
VRL339 15953 475986831
VRL34 29620 659050873
VRL340 37101 1108822824
VRL341 14316 427808954
VRL342 37334 1114025091
VRL343 14994 447344151
VRL344 37333 1114773948
VRL345 2938 87808607
VRL346 36929 1103098613
VRL347 3203 95653246
VRL348 37305 1113491932
VRL349 3215 96002981
VRL35 5227 145555528
VRL350 37288 1113064958
VRL351 16286 486144130
VRL352 37084 1107504618
VRL353 6424 191904149
VRL354 37076 1107432971
VRL355 20302 605934045
VRL356 37031 1105952216
VRL357 9832 293761710
VRL358 36863 1101228020
VRL359 37008 1104966084
VRL36 22974 665203149
VRL360 3180 94878679
VRL361 37256 1111474329
VRL362 36493 1089874613
VRL363 36961 1104073846
VRL364 22011 657495345
VRL365 37040 1106411997
VRL366 14424 430928209
VRL367 37512 1115966636
VRL368 32908 983056718
VRL369 37272 1113460437
VRL37 810 20017439
VRL370 21437 640266041
VRL371 37031 1105934353
VRL372 12962 387102364
VRL373 37130 1108723285
VRL374 12932 386175225
VRL375 36661 1094921729
VRL376 13350 398759112
VRL377 37127 1108347763
VRL378 12643 377434462
VRL379 37089 1107210769
VRL38 23653 664319814
VRL380 6009 179371181
VRL381 37135 1108608927
VRL382 13706 409227550
VRL383 37191 1109653846
VRL384 14124 420580642
VRL385 37487 1119207298
VRL386 4769 142428949
VRL387 37392 1116764909
VRL388 4696 140298925
VRL389 37117 1108332871
VRL39 3113 82392829
VRL390 4890 146149213
VRL391 36462 1088391604
VRL392 5358 159900353
VRL393 36324 1083869001
VRL394 5527 164048842
VRL395 37683 1121763094
VRL396 4884 145039704
VRL397 37843 1127535366
VRL398 4948 147671027
VRL399 37836 1126567483
VRL4 204160 233127006
VRL40 25118 663967751
VRL400 30530 908724895
VRL401 37853 1126033212
VRL402 9402 280228621
VRL403 37824 1127171611
VRL404 2984 88807861
VRL405 37488 1117304491
VRL406 7726 230243891
VRL407 37941 1129305563
VRL408 37532 1120445998
VRL409 1997 59668580
VRL41 3558 86379552
VRL410 37597 1124750543
VRL411 7196 214942299
VRL412 36501 1085327765
VRL413 17277 515643148
VRL414 37644 1124295123
VRL415 16185 483323509
VRL416 37607 1123409112
VRL417 25114 750053377
VRL418 37125 1108729574
VRL419 10553 315107198
VRL42 26194 663182503
VRL420 37302 1115666751
VRL421 4990 149019167
VRL422 36729 1102119676
VRL423 4057 115151724
VRL424 38007 1099550726
VRL425 22700 657113389
VRL426 36233 1080568498
VRL427 20238 604653619
VRL428 36126 1079468132
VRL429 6493 194076254
VRL43 4328 101944484
VRL430 36442 1089136069
VRL431 3660 109381809
VRL432 36355 1085843904
VRL433 36149 1079760964
VRL434 2736 81726358
VRL435 36514 1090498832
VRL436 36471 1088861655
VRL437 2690 80317374
VRL438 36498 1089640784
VRL439 36485 1089316635
VRL44 29984 666877316
VRL440 4058 121149887
VRL441 36480 1089187037
VRL442 20291 605840055
VRL443 36692 1094502133
VRL444 20044 597880417
VRL445 37103 1105397042
VRL446 24055 717589519
VRL447 37470 1114694532
VRL448 13938 413639342
VRL449 38145 1132689212
VRL45 3451 91141747
VRL450 3923 116515899
VRL451 38113 1131951323
VRL452 8619 255935606
VRL453 38110 1131479978
VRL454 6988 207482376
VRL455 38120 1132052489
VRL456 11014 327172908
VRL457 38163 1132954792
VRL458 16013 428292237
VRL459 36504 1089824880
VRL46 30883 661756568
VRL460 14633 436963840
VRL461 36465 1089798277
VRL462 9067 270816317
VRL463 36634 1094347090
VRL464 16099 480946357
VRL465 36585 1092939862
VRL466 26936 804680772
VRL467 36579 1092745835
VRL468 19701 588548265
VRL469 36409 1087850765
VRL47 3929 112589883
VRL470 7691 229888754
VRL471 36081 1076074075
VRL472 28426 846960086
VRL473 36019 1068363395
VRL474 4444 132299980
VRL475 36633 1089995904
VRL476 23595 696576942
VRL477 37531 1120498878
VRL478 19177 572789700
VRL479 36329 1085562659
VRL48 24802 665944663
VRL480 26285 785357524
VRL481 35888 1072345405
VRL482 4109 122793098
VRL483 39032 1088756013
VRL484 4213 123289782
VRL485 39151 1092596411
VRL486 38081 1083256263
VRL487 2263 67412935
VRL488 27324 668401308
VRL489 7097 182616091
VRL49 8275 198201474
VRL490 25997 671604063
VRL491 4277 121193759
VRL492 31524 666351770
VRL493 3290 68838760
VRL494 43972 655693002
VRL495 5530 71370503
VRL496 48738 648571336
VRL497 9421 67819271
VRL498 26445 670372831
VRL499 13754 67222477
VRL5 280535 596120261
VRL50 23424 665657614
VRL500 62916 638793358
VRL501 29790 328182626
VRL502 40336 655572701
VRL503 25762 668632386
VRL504 31310 78137944
VRL51 2191 65297472
VRL52 26410 663489762
VRL53 7941 227472348
VRL54 23414 659312050
VRL55 3877 115050329
VRL56 23459 666498757
VRL57 7604 224410146
VRL58 24455 660244246
VRL59 12870 379798658
VRL6 23490 82601179
VRL60 37083 1108550266
VRL61 30424 909649509
VRL62 37114 1109250740
VRL63 8058 240802925
VRL64 37139 1109667181
VRL65 5932 176025665
VRL66 23342 665139591
VRL67 2947 83685526
VRL68 23436 666369475
VRL69 13040 336264336
VRL7 253022 337221008
VRL70 22381 659575407
VRL71 3639 104776154
VRL72 23042 660595591
VRL73 11913 342221608
VRL74 22812 660547330
VRL75 11733 323111289
VRL76 22415 662597999
VRL77 5272 151310692
VRL78 22659 662437788
VRL79 1998 59113996
VRL8 248767 410113095
VRL80 22836 664299533
VRL81 2347 68539361
VRL82 23853 668562404
VRL83 7629 218240519
VRL84 22604 662478335
VRL85 8047 225950637
VRL86 22724 664920515
VRL87 2635 78589590
VRL88 22494 660735890
VRL89 11922 342043890
VRL9 237501 450889113
VRL90 24307 666168961
VRL91 11967 342780598
VRL92 23312 667704534
VRL93 14252 363117989
VRL94 24206 666022023
VRL95 11654 345441201
VRL96 24197 667442447
VRL97 12113 342896632
VRL98 22579 662522993
VRL99 12505 349482081
VRT1 151992 879089965
VRT10 1171 26255719
VRT100 23 1143934087
VRT101 18 187861254
VRT102 226 1172298670
VRT103 6 287514912
VRT104 21 1147858523
VRT105 8 396461523
VRT106 20 1173136487
VRT107 40 408449657
VRT108 21 1168748140
VRT109 6 417779009
VRT11 293 13983146
VRT110 18 1151861742
VRT111 8 407907477
VRT112 23 1107646329
VRT113 13 713326122
VRT114 23 1144234985
VRT115 9 420614896
VRT116 134 1180161953
VRT117 79 1025790260
VRT118 1 843366180
VRT119 1 842558404
VRT12 62 1165207373
VRT120 1 707956555
VRT121 1 635713434
VRT122 2 1006930617
VRT123 6 953838719
VRT124 1 690654357
VRT125 2 1036857559
VRT126 1 481763206
VRT127 4 1057207450
VRT128 35 773383371
VRT129 4329 1156513083
VRT13 11 316368323
VRT130 16002 459253055
VRT131 420799 391698539
VRT132 7919 9100750
VRT133 384098 422334073
VRT134 62589 120122603
VRT135 67 1170083182
VRT136 5 206181523
VRT137 47 1183370565
VRT138 7 243122995
VRT139 23 1181318093
VRT14 42 1131640503
VRT140 23 251314286
VRT141 405 1094560939
VRT142 4 347682430
VRT143 54 1154458892
VRT144 10 313635714
VRT145 43 1146391866
VRT146 5 240249405
VRT147 31 1184009833
VRT148 15 299492187
VRT149 28 1054983542
VRT15 51 1151263002
VRT150 13 348062730
VRT151 94 852284325
VRT152 2 696540660
VRT153 4 904864528
VRT154 33 731071093
VRT155 37 1164742986
VRT156 36 528124428
VRT157 37 1123854199
VRT158 9 481951495
VRT159 156 1183779024
VRT16 1 25018904
VRT160 6 312654085
VRT161 1589 1155278298
VRT162 64 1040389365
VRT163 5 1114313003
VRT164 20 655696990
VRT165 32 1165038142
VRT166 10 359729387
VRT167 37 977985462
VRT168 3 346034432
VRT169 12 843150289
VRT17 21 1144265373
VRT170 91 688705431
VRT171 43 1161336176
VRT172 12 337935768
VRT173 33 1177732884
VRT174 10 315490636
VRT175 29 1133415830
VRT176 19 985076759
VRT177 13 1094615957
VRT178 1 168556870
VRT179 302 1175670063
VRT18 11 861785425
VRT180 22 599394507
VRT181 42 1159071038
VRT182 12 363275175
VRT183 38 1157829262
VRT184 17 1062116002
VRT185 43 1173707836
VRT186 29 886034587
VRT187 55 1165077059
VRT188 8 313502651
VRT189 30 1158773265
VRT19 37 1039301283
VRT190 18 307245863
VRT191 11 1125864671
VRT192 6 320509967
VRT193 37 1160120295
VRT194 11 302784051
VRT195 26 986334395
VRT196 4 443026194
VRT197 53 1177747146
VRT198 16 515509915
VRT199 24 1145214277
VRT2 3 141387178
VRT20 2 394160013
VRT200 20 842461686
VRT201 39 1152236201
VRT202 5 287434963
VRT203 28 1173216529
VRT204 19 516043856
VRT205 30 1178674121
VRT206 19 723703127
VRT207 44 1152763700
VRT208 13 540214668
VRT209 17 1143715445
VRT21 30 1168492153
VRT210 18 1174563204
VRT211 16 342884613
VRT212 27 1175110025
VRT213 23 1166697769
VRT214 8 219831677
VRT215 48 1160289310
VRT216 18 759308542
VRT217 23 1171047943
VRT218 10 534818626
VRT219 36 1170770868
VRT22 29 742092719
VRT220 16 566704607
VRT221 28 1134330417
VRT222 303 755315061
VRT223 38 1165356567
VRT224 8 214956194
VRT225 51 1172310789
VRT226 31 991676973
VRT227 2 484884812
VRT228 6 1101564199
VRT229 5 549920900
VRT23 30 1174531068
VRT230 21 1018602957
VRT231 1 218912229
VRT232 38 1176533902
VRT233 7 517093999
VRT234 20 1141381288
VRT235 16 736377496
VRT236 15 1167658288
VRT237 26 287064166
VRT238 37 1177840384
VRT239 14 728760872
VRT24 7 355601113
VRT240 40 1171007353
VRT241 2 181314551
VRT242 43 1178099053
VRT243 11 1013144776
VRT244 6 1099894888
VRT245 4 531276777
VRT246 13 1174401695
VRT247 6 321859036
VRT248 22 1163106414
VRT249 34 516457854
VRT25 20 1126401709
VRT250 31 1159946079
VRT251 29 737532156
VRT252 150 1081754494
VRT253 19 1093025330
VRT254 6 295537066
VRT255 43 1171949486
VRT256 37 796605274
VRT257 40 1107875829
VRT258 15 1063299345
VRT259 13 1138287802
VRT26 38 395533534
VRT260 16 1105290063
VRT261 15 1130244137
VRT262 15 1036912531
VRT263 41 1159354291
VRT264 14 908068324
VRT265 53 1145605856
VRT266 25 983778854
VRT267 4 1160654489
VRT268 6 1055180276
VRT269 2 252574183
VRT27 147 10842596
VRT270 12 1164796003
VRT271 17 1117378186
VRT272 2 199725448
VRT273 18 1130657423
VRT274 32 1035659056
VRT275 13 1152863804
VRT276 20 1165857068
VRT277 1 23158203
VRT278 36 1137134883
VRT279 20 1148361345
VRT28 586 15797052
VRT280 25 1177250795
VRT281 28 1154446904
VRT282 1 36442654
VRT283 32 1171156725
VRT284 6 937247744
VRT285 8 1173255441
VRT286 12 1154695746
VRT287 1 47172269
VRT288 18 1146578510
VRT289 18 1017766614
VRT29 2343 67436863
VRT290 39 1149972114
VRT291 43 1174331880
VRT292 1 61310853
VRT293 31 1180724268
VRT294 36 485985627
VRT295 46 1136862290
VRT296 31 540562669
VRT297 1 1377224146
VRT298 1 1246042375
VRT299 1 1134302525
VRT3 31 1168751005
VRT30 231538 799486550
VRT300 1 1092803421
VRT301 1 995116563
VRT302 1 979649957
VRT303 2 861035206
VRT304 4 750732872
VRT305 1 1415942608
VRT306 1 1279781030
VRT307 1 1144564707
VRT308 1 1114117749
VRT309 1 1027171557
VRT31 18620 13607200
VRT310 1 998592877
VRT311 3 1103810273
VRT312 1 183585054
VRT313 3 326589081
VRT314 1 1950672471
VRT315 1 1882935974
VRT316 1 1702342136
VRT317 1 1361375652
VRT318 1 1317398316
VRT319 1 1293891082
VRT32 201992 813214419
VRT320 1 1269970046
VRT321 1 1248769876
VRT322 1 1238911699
VRT323 1 1201415365
VRT324 1 1199165587
VRT325 1 1184551933
VRT326 1 1183987023
VRT327 1 1134708421
VRT328 1 1024245046
VRT329 1 993383533
VRT33 31 452289725
VRT330 3 1080922639
VRT331 38 873017596
VRT332 42 1153692861
VRT333 3 503564646
VRT334 47 1177562654
VRT335 41652 382184693
VRT34 196759 156490806
VRT35 335335 229992764
VRT36 176839 120754439
VRT37 133023 105741590
VRT38 298628 205468986
VRT39 291757 181465675
VRT4 30955 1101865239
VRT40 328231 606768860
VRT41 95677 1060886498
VRT42 145106 21008965
VRT43 75789 25336814
VRT44 13711 1164642593
VRT45 6492 595515114
VRT46 6958 1164949634
VRT47 18 646516563
VRT48 48 1183553258
VRT49 227 233550951
VRT5 74951 70628501
VRT50 39 902622871
VRT51 3 1023379555
VRT52 2 589523540
VRT53 6 1150383114
VRT54 2 310907973
VRT55 24 1179751921
VRT56 13 344051702
VRT57 43 1172808323
VRT58 20 319354703
VRT59 1 839681426
VRT6 37396 74041240
VRT60 1 825560060
VRT61 2 1082779519
VRT62 2 758561446
VRT63 6 1178831395
VRT64 19 1164471784
VRT65 1 46063367
VRT66 22 1169870462
VRT67 332 504305975
VRT68 49 1183118178
VRT69 3 26813209
VRT7 18698 27611025
VRT70 1 772932187
VRT71 1 662004353
VRT72 2 911653698
VRT73 1 364230008
VRT74 4 1133578097
VRT75 493 875502265
VRT76 28 1159189661
VRT77 1 81199652
VRT78 27 1178866037
VRT79 2 65038611
VRT8 9349 597580446
VRT80 24 1169138155
VRT81 4 106598356
VRT82 29 755437537
VRT83 41 289507176
VRT84 35 926559538
VRT85 2 1080114977
VRT86 3 1012738546
VRT87 2 458353277
VRT88 11 1181336336
VRT89 462 807789205
VRT9 4685 4674270
VRT90 10 1126531868
VRT91 3 244017515
VRT92 624 928535178
VRT93 1 313568160
VRT94 4 1044936093
VRT95 3 637611209
VRT96 6 1049980901
VRT97 3 425844009
VRT98 38 1127532336
VRT99 6 357716939
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 262.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
1944159 270484909587 Triticum aestivum
8923194 265452762967 Severe acute respiratory syndrome coronavirus 2
113378 205855653923 Hordeum vulgare
1347594 126088488918 Hordeum vulgare subsp. vulgare
520 106587373982 Hordeum bulbosum
164 93011095388 Viscum album
29876 92980158773 Hordeum vulgare subsp. spontaneum
10050985 46280856690 Mus musculus
27842260 36954905438 Homo sapiens
176206 24709964086 Escherichia coli
1627 22052873125 Triturus cristatus
29811 21128005736 Avena sativa
1547 20633298192 Chenopodium quinoa
2640787 20263227802 Arabidopsis thaliana
34666 17210066696 Klebsiella pneumoniae
768 17031737000 Bombina variegata
2244015 16210419326 Bos taurus
1732311 13758484804 Danio rerio
29 13694558562 Adonis annua
312152 13122116615 Arachis hypogaea
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
245 Aug 2021 940513260726 231982592
246 Oct 2021 1014763752113 233642893
247 Dec 2021 1053275115030 234557297
248 Feb 2022 1173984081721 236338284
249 Apr 2022 1266154890918 237520318
250 Jun 2022 1395628631187 239017893
251 Aug 2022 1492800704497 239915786
252 Oct 2022 1562963366851 240539282
253 Dec 2022 1635594138493 241015745
254 Feb 2023 1731302248418 241830635
255 Apr 2023 1826746318813 242554936
256 Jun 2023 1966479976146 243560863
257 Aug 2023 2112058517945 246119175
258 Oct 2023 2433391164875 247777761
259 Dec 2023 2570711588044 249060436
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 3213818003787 250803006
261 Jun 2024 3387240663231 251094334
262 Aug 2024 3675462701077 251998350
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
245 Aug 2021 13888187863722 1653427055
246 Oct 2021 14599101574547 1721064101
247 Dec 2021 14922033922302 1734664952
248 Feb 2022 15428122140820 1750505007
249 Apr 2022 16071520702170 1781374217
250 Jun 2022 16710373006600 1796349114
251 Aug 2022 17511809676629 2024099677
252 Oct 2022 18231960808828 2167900306
253 Dec 2022 19086596616569 2241439349
254 Feb 2023 20116642176263 2337838461
255 Apr 2023 20926504760221 2440470464
256 Jun 2023 21791125594114 2611654455
257 Aug 2023 22294446104543 2631493489
258 Oct 2023 23600199887231 2775205599
259 Dec 2023 24651580464335 2863228552
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 27225116587937 3333621823
261 Jun 2024 27900199328333 3380877515
262 Aug 2024 29643594176326 3569715357
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
245 Aug 2021 440578422611 498305045
246 Oct 2021 449891016597 508319391
247 Dec 2021 455870853358 514158576
248 Feb 2022 465013156502 524464601
249 Apr 2022 474421076448 534770586
250 Jun 2022 485056129761 546991572
251 Aug 2022 497501380386 560196830
252 Oct 2022 511476787957 574020080
253 Dec 2022 611850391049 649918843
254 Feb 2023 630615054587 672261981
255 Apr 2023 636291358227 678332682
256 Jun 2023 643127590034 683922756
257 Aug 2023 646176166908 686271945
258 Oct 2023 659924904311 701336089
259 Dec 2023 668807109326 715803123
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 689648317082 741066498
261 Jun 2024 695405769319 746753803
262 Aug 2024 706085554263 755907377
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
245 Aug 2021 39930167315 106995218
246 Oct 2021 40168874815 107569935
247 Dec 2021 41143480750 109379021
248 Feb 2022 41321107981 109809966
249 Apr 2022 41324192343 109820387
250 Jun 2022 41999358847 111142107
251 Aug 2022 43852280645 115103527
252 Oct 2022 43860512749 115123306
253 Dec 2022 44009657455 115552377
254 Feb 2023 46465508548 121067644
255 Apr 2023 46567924833 121186672
256 Jun 2023 47302831210 122798571
257 Aug 2023 48289699026 124421006
258 Oct 2023 50868407906 130654568
259 Dec 2023 51568356978 132355132
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 53492243256 135115766
261 Jun 2024 54512778803 135446337
262 Aug 2024 77026446552 187321998
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
August 15 2024
NCBI-GenBank Flat File Release 262.0
Bacterial Sequences (Part 1)
139664 loci, 536999711 bases, from 139664 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, possibly 'LINEAGE'. But because changes like this can be
very disruptive for customers, implementation has not yet been scheduled.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA)
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L,
Karsch-Mizrachi I, "GenBank 2024 update", Nucleic Acids Research,
Volume 52, Issue D1, January 2024, pp. D134-D137.
PMID: 37889039
PMCID: PMC10767886
DOI: 10.1093/nar/gkad903
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, EW. et al, Nucleic Acids Res. 52(D1):D134-D137 (2024)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Genome Workbench can be used to submit revisions to
previous submissions. In addition, suggestions and corrections can
be sent by electronic mail to: [email protected]. Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
Andrea Gocke, Anjanette Johnston, Erica Lam,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
Beverly Underwood, and Linda Yankie
GenBank Release Coordination
Mark Cavanaugh
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
Majda Valjavec-Gratian
Project Direction/Leadership
Steve Sherry : Acting Director, NLM
Kim Pruitt : Acting Director, NCBI
Valerie Schneider : Acting Branch Chief, NCBI/IEB
Eugene Yaschenko : Chief Technology Officer, NCBI/IRB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
