LOCUS NM_010311 2435 bp mRNA linear ROD 20-NOV-2017
DEFINITION Mus musculus guanine nucleotide binding protein, alpha z subunit
(Gnaz), mRNA.
ACCESSION NM_010311
VERSION NM_010311.3
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 2435)
AUTHORS Vancura P, Abdelhadi S, Csicsely E, Baba K, Tosini G, Iuvone PM and
Spessert R.
TITLE Gnaz couples the circadian and dopaminergic system to G
protein-mediated signaling in mouse photoreceptors
JOURNAL PLoS ONE 12 (10), E0187411 (2017)
PUBMED 29088301
REMARK GeneRIF: present study suggest that Gnaz links the circadian
clockwork-via dopamine acting on D4 receptors-to G protein-mediated
signaling in intact but not diabetic retina
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 2435)
AUTHORS Fenske RJ, Cadena MT, Harenda QE, Wienkes HN, Carbajal K, Schaid
MD, Laundre E, Brill AL, Truchan NA, Brar H, Wisinski J, Cai J,
Graham TE, Engin F and Kimple ME.
TITLE The Inhibitory G Protein alpha-Subunit, Galphaz, Promotes Type 1
Diabetes-Like Pathophysiology in NOD Mice
JOURNAL Endocrinology 158 (6), 1645-1658 (2017)
PUBMED 28419211
REMARK GeneRIF: Galphaz plays a key role in beta-cell signaling that
becomes dysfunctional in the type 1 diabetes setting, accelerating
the death of beta-cells, which promotes further accumulation of
immune cells in the pancreatic islets, and inhibiting a restorative
proliferative response.
REFERENCE 3 (bases 1 to 2435)
AUTHORS Jin S, Martinelli DC, Zheng X, Tessier-Lavigne M and Fan CM.
TITLE Gas1 is a receptor for sonic hedgehog to repel enteric axons
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 112 (1), E73-E80 (2015)
PUBMED 25535338
REFERENCE 4 (bases 1 to 2435)
AUTHORS Regard JB, Malhotra D, Gvozdenovic-Jeremic J, Josey M, Chen M,
Weinstein LS, Lu J, Shore EM, Kaplan FS and Yang Y.
TITLE Activation of Hedgehog signaling by loss of GNAS causes heterotopic
ossification
JOURNAL Nat. Med. 19 (11), 1505-1512 (2013)
PUBMED 24076664
REFERENCE 5 (bases 1 to 2435)
AUTHORS Kimple ME, Moss JB, Brar HK, Rosa TC, Truchan NA, Pasker RL,
Newgard CB and Casey PJ.
TITLE Deletion of GalphaZ protein protects against diet-induced glucose
intolerance via expansion of beta-cell mass
JOURNAL J. Biol. Chem. 287 (24), 20344-20355 (2012)
PUBMED 22457354
REMARK GeneRIF: Deletion of GalphaZ protein protects against diet-induced
glucose intolerance via expansion of beta-cell mass.
REFERENCE 6 (bases 1 to 2435)
AUTHORS Zigman JM, Westermark GT, LaMendola J and Steiner DF.
TITLE Expression of cone transducin, Gz alpha, and other G-protein
alpha-subunit messenger ribonucleic acids in pancreatic islets
JOURNAL Endocrinology 135 (1), 31-37 (1994)
PUBMED 8013366
REFERENCE 7 (bases 1 to 2435)
AUTHORS Wilkie TM, Gilbert DJ, Olsen AS, Chen XN, Amatruda TT, Korenberg
JR, Trask BJ, de Jong P, Reed RR, Simon MI et al.
TITLE Evolution of the mammalian G protein alpha subunit multigene family
JOURNAL Nat. Genet. 1 (2), 85-91 (1992)
PUBMED 1302014
REMARK Review article
REFERENCE 8 (bases 1 to 2435)
AUTHORS Strathmann M, Wilkie TM and Simon MI.
TITLE Diversity of the G-protein family: sequences from five additional
alpha subunits in the mouse
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 86 (19), 7407-7409 (1989)
PUBMED 2508088
REFERENCE 9 (bases 1 to 2435)
AUTHORS Fong HK, Yoshimoto KK, Eversole-Cire P and Simon MI.
TITLE Identification of a GTP-binding protein alpha subunit that lacks an
apparent ADP-ribosylation site for pertussis toxin
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 85 (9), 3066-3070 (1988)
PUBMED 3129724
REFERENCE 10 (bases 1 to 2435)
AUTHORS Tanabe,T., Nukada,T., Nishikawa,Y., Sugimoto,K., Suzuki,H.,
Takahashi,H., Noda,M., Haga,T., Ichiyama,A., Kangawa,K. et al.
TITLE Primary structure of the alpha-subunit of transducin and its
relationship to ras proteins
JOURNAL Nature 315 (6016), 242-245 (1985)
PUBMED 3923359
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from AC142500.23.
[WARNING] On Dec 12, 2017 this sequence was replaced by
NM_010311.4.
On Nov 17, 2006 this sequence version replaced NM_010311.2.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK080716.1, SRR1660813.162991.1
[ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN00849374, SAMN00849375
[ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-152 AC142500.23 121728-121879
153-218 AC142500.23 133288-133353
219-1425 AC142500.23 145431-146637
1426-2435 AC142500.23 169365-170374
FEATURES Location/Qualifiers
source 1..2435
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="10"
/map="10 38.48 cM"
gene 1..2435
/gene="Gnaz"
/gene_synonym="AI847979; Gz"
/note="guanine nucleotide binding protein, alpha z
subunit"
/db_xref="GeneID:14687"
/db_xref="MGI:MGI:95780"
misc_feature 625..627
/gene="Gnaz"
/gene_synonym="AI847979; Gz"
/note="upstream in-frame stop codon"
CDS 703..1770
/gene="Gnaz"
/gene_synonym="AI847979; Gz"
/note="gz-alpha; g(x) alpha chain"
/codon_start=1
/product="guanine nucleotide-binding protein G(z) subunit
alpha"
/protein_id="NP_034441.1"
/db_xref="CCDS:CCDS23922.1"
/db_xref="GeneID:14687"
/db_xref="MGI:MGI:95780"
/translation="MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNS
GKSTIVKQMKIIHSGGFNLDACKEYKPLIIYNAIDSLTRIIRALAALKIDFHNPDRAY
DAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFGRSSEYHLEDNAAYYLNDL
ERIAAPDYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEG
VTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLA
EKIRRIPLSVCFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQ
FVFDAVTDVIIQNNLKYIGLC"
ORIGIN
1 gcggcggagc gtgtgtgcca cccgcggacc ggtcacgtcc tcgcgcggcc gccggcaccc
61 gcttcgtgca gaaccagggc gccacagccc tacgctcgcg gccccgcccc gccgggtgca
121 gctcgaccga cgcacgaagc cgcgcccggg agtttcaggc atttgcaggg ctgatgagga
181 gtgaaatgca aagtccttcg caagccttat gaaaactggt gaagggccgg atgcaaggca
241 gggagccgga gcagcctgag gcaggggggc ctcagggagc gctgggccct ccagccgtgc
301 ttagaaacat cgccacagca accagcgagc agacagcagt agcctgggca gacgcaagcg
361 gacagcttcc taccgtggca gagtacaggg aatgactacg gcaaatcagg ccacactgct
421 gacaagggag gtggagtgtc actagagggg agggtgtggt ctctgcccca ctgcaccaag
481 cgccatgccc acaggagaag cggtactggg gcagggattg ctctgtgaca cagcctcgcc
541 ccaaagccag tgctgagcac ggccgggtca gctgcctctc tcatctgccc gtcacaccag
601 cccacgtttg agcatccctc gttgtgacca ttctgtttgg cgagggggag aggcgcccac
661 cctgtgttct gcatctgggg ggtggcccgc tgctgccgga ccatgggatg tcggcaaagc
721 tcagaggaaa aagaggcagc gaggcggtcc cggagaattg accgccacct gcgctccgaa
781 agccagcggc agcgccgtga aatcaaactt ctcctgctgg gcaccagcaa ctcgggcaag
841 agcaccatcg tcaagcagat gaagatcatc cacagcgggg gcttcaacct ggacgcctgc
901 aaggagtaca agcccctcat catctacaac gccatcgact cgctgacccg gatcatccgg
961 gccctggctg ccctcaagat cgatttccac aaccctgacc gtgcctacga cgctgtgcag
1021 ctctttgctc tgactggccc agcagagagc aagggtgaga ttacacctga gctgctgggt
1081 gtcatgcgac ggctctgggc tgacccaggg gcccaggcct gctttggccg ctctagcgag
1141 taccacctgg aggacaatgc agcctactac ctgaacgacc tggagcgcat cgcagcgccc
1201 gactacatcc ccacggtgga ggatatccta cgctcccggg acatgaccac gggcattgtg
1261 gagaacaagt tcaccttcaa ggagcttacc ttcaagatgg tggacgtggg cgggcagagg
1321 tcagaacgca aaaagtggat ccattgcttt gaaggcgtca cagccatcat cttctgtgtg
1381 gagctcagtg gctatgacct gaagctctat gaggacaacc agacgagccg gatggcggag
1441 agcctgcgcc tctttgactc catctgcaac aacaactggt tcatcaacac ctcgctcatc
1501 ctcttcctga acaagaagga cctcctggca gagaagatcc ggcgtatccc gctcagcgtc
1561 tgcttcccag agtacaaggg tcagaacacg tacgaggaag ccgcggtcta catccaacgt
1621 cagttcgagg acctcaaccg caacaaggag accaaggaga tctattcgca cttcacttgt
1681 gccaccgaca ccagtaacat ccagtttgtg tttgacgcag tgacagatgt catcatacag
1741 aacaatctca agtacatcgg cctttgctga ggagccgggc gcagcctgct cgcctgtggt
1801 gaaacccatg gggtgtcaca ccccacacct catgctcgag aggcccgacc caggggcaga
1861 aaacggggct tgaagagtgt gtccccatcc cacccccagc ctctgccttc ttggccccac
1921 atctctgcaa acataaatat atttggatag attgctaggt aggtagacac acagacacac
1981 acacagacac acacacacac agacacacgc acgcacgcac atctggagag ggcatagttc
2041 tccagagcgt caaggtttcc tgaagttttc aaaagctgct gtcacaattt cattccgagg
2101 ccatcttgcc cctccccctt cactctgcct tcctgagttg gccccactct gcacgggagg
2161 gagggcccac cttagactgc tggggagagg ccacagggct gggggccagg tccggccagc
2221 tgtgcccatc gcctgggaga aggccagctc accaactgag ctctggactg gggactaccg
2281 ctgaccagga gggaagcctg gagccgcacc cgactcagcc actctgcgtc acattcgtcc
2341 tgtacctagg accggaggaa agacgtgact gctctaaccg gacctctgac taccggtggc
2401 ttttacaaaa aaaaaacagc taaaacgtac tcagc
//