Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AY014273.1
FASTA Graphics
LOCUS AY014273 608 bp mRNA linear HTC 13-JUL-2001 DEFINITION Homo sapiens FKSG29 (FKSG29) mRNA, complete cds. ACCESSION AY014273 VERSION AY014273.1 KEYWORDS HTC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 608) AUTHORS Wang,Y.-G. and Gong,L. TITLE Cloning and characterization of FKSG29, a novel gene located on human chromosome 13 JOURNAL Unpublished REFERENCE 2 (bases 1 to 608) AUTHORS Wang,Y.-G. TITLE Direct Submission JOURNAL Submitted (26-NOV-2000) Beijing Fengkesheng Function Gene Technology Ltd., 4 Tou Tiao Lu Chang Street, Xuanwu District, Beijing 100050, P.R. China FEATURES Location/Qualifiers source 1..608 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="13" gene 1..608 /gene="FKSG29" CDS 40..432 /gene="FKSG29" /codon_start=1 /product="FKSG29" /protein_id="AAG50356.1" /translation="MFTTWPFTEKYLPVPAVEGYIASSFQSNLLPGNVNSLLVLVICY LWEPILSLLADDENSVIYHNTNLGIKLSIRHFCKISIYFRSRTKVKPSVNESCLLVQA KWDIWQQSPGVLGALLLTASSSHWAARC" ORIGIN 1 tatctttgat ctcttgcctc tttatcttcc aaacctaaaa tgtttaccac ctggcccttt 61 acagaaaaat atttgccagt ccctgctgta gaaggttata tagccagcag ctttcaaagt 121 aaccttttac ctggaaatgt gaattctctc ttagttctgg tcatctgtta tttgtgggag 181 ccaatcctct ctctgttggc tgatgatgag aattctgtta tataccacaa cacaaacttg 241 gggataaaac tttccattag gcatttctgt aaaatttcca tctattttag aagcagaact 301 aaggtgaagc ccagtgtgaa tgaatcctgc ttgttggtac aagccaagtg ggacatttgg 361 cagcaaagcc caggagtcct tggtgctctt cttttaactg cctcctcatc tcattgggct 421 gcccggtgtt aactggttga ttatcacctc tgtgttttgc ctgcaaggaa agaagctact 481 gacacccaga gtggctcagc gatactcaca cgtgctttca gttactttcg cagcatttgg 541 ttaaagtgag tttagctgca catcctcact tggtaacatt ctgtggctgt gaaaattgtt 601 tctctctt //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on