Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: X96597.1
FASTA Graphics
LOCUS X96597 1232 bp DNA linear PRI 09-SEP-2004 DEFINITION H.sapiens gene encoding G protein coupled receptor. ACCESSION X96597 VERSION X96597.1 KEYWORDS G-protein coupled receptor. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 AUTHORS Stam,N.J., Klomp,J., Van de Heuvel,N. and Olijve,W. TITLE Molecular cloning and characterization of a novel orphan receptor (P2P) expressed in human pancreas that shows high structural homology to the P2U purinoceptor JOURNAL FEBS Lett. 384 (3), 260-264 (1996) PUBMED 8617367 REFERENCE 2 (bases 1 to 1232) AUTHORS Stam,N.J. TITLE Direct Submission JOURNAL Submitted (13-MAR-1996) N.J. Stam, NV. Organon, Deptartment of Biotechnology and Biochemistry, P.O. Box 20, 5340 BH Oss, Netherlands FEATURES Location/Qualifiers source 1..1232 /organism="Homo sapiens" /mol_type="genomic DNA" /db_xref="taxon:9606" /clone_lib="human placenta genomic DNA library" CDS 90..1187 /codon_start=1 /product="G protein coupled receptor" /protein_id="CAA65415.1" /db_xref="GDB:3778136" /db_xref="GOA:P51582" /db_xref="HGNC:HGNC:8542" /db_xref="InterPro:IPR000018" /db_xref="InterPro:IPR000276" /db_xref="InterPro:IPR002286" /db_xref="InterPro:IPR017452" /db_xref="PDB:2B6Q" /db_xref="UniProtKB/Swiss-Prot:P51582" /translation="MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAV VFVLGLGLNAPTLWLFIFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWP FGTEICKFVRFLFYWNLYCSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVW LVVAGCLVPNLFFVTTSNKGTTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLV CYGLMARRLYQPLPGSAQSSSRLRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEA DCRVLNIVNVVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASS LALVSLPEDSSCRWAATPQDSSCSTPRADRL" ORIGIN 1 ctctactttt tttgctccag ctcagggatg ggggtgggca gggaaatcct gccaccctca 61 cttctcccct tcccatctcc aggggggcca tggccagtac agagtcctcc ctgttgagat 121 ccctaggcct cagcccaggt cctggcagca gtgaggtgga gctggactgt tggtttgatg 181 aggatttcaa gttcatcctg ctgcctgtga gctatgcagt tgtctttgtg ctgggcttgg 241 gccttaacgc cccaacccta tggctcttca tcttccgcct ccgaccctgg gatgcaacgg 301 ccacctacat gttccacctg gcattgtcag acaccttgta tgtgctgtcg ctgcccaccc 361 tcatctacta ttatgcagcc cacaaccact ggccctttgg cactgagatc tgcaagttcg 421 tccgctttct tttctattgg aacctctact gcagtgtcct tttcctcacc tgcatcagcg 481 tgcaccgcta cctgggcatc tgccacccac ttcgggcact acgctggggc cgccctcgcc 541 tcgcaggcct tctctgcctg gcagtttggt tggtcgtagc cggctgcctc gtgcccaacc 601 tgttctttgt cacaaccagc aacaaaggga ccaccgtcct gtgccatgac accactcggc 661 ctgaagagtt tgaccactat gtgcacttca gctcggcggt catggggctg ctctttggcg 721 tgccctgcct ggtcactctt gtttgctatg gactcatggc tcgtcgcctg tatcagccct 781 tgccaggctc tgcacagtcg tcttctcgcc tccgctctct ccgcaccata gctgtggtgc 841 tgactgtctt tgctgtctgc ttcgtgcctt tccacatcac ccgcaccatt tactacctgg 901 ccaggctgtt ggaagctgac tgccgagtac tgaacattgt caacgtggtc tataaagtga 961 ctcggcccct ggccagtgcc aacagctgcc tggatcctgt gctctacttg ctcactgggg 1021 acaaatatcg acgtcagctc cgtcagctct gtggtggtgg caagccccag ccccgcacgg 1081 ctgcctcttc cctggcacta gtgtccctgc ctgaggatag cagctgcagg tgggcggcca 1141 ccccccagga cagtagctgc tctactccta gggcagatag attgtaacac gggaagccgg 1201 gaagtgagag aaaaggggat gagtgcaggg ca //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on