Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AF372217.1
FASTA Graphics
LOCUS AF372217 964 bp mRNA linear ROD 19-JUL-2001 DEFINITION Rattus norvegicus brain tropomyosin alpha isoform mRNA, complete cds, alternatively spliced. ACCESSION AF372217 VERSION AF372217.1 KEYWORDS . SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 964) AUTHORS Cooley,B.C. and Bergtrom,G. TITLE Multiple combinations of alternatively spliced exons in rat tropomyosin-alpha gene mRNA: evidence for 20 new isoforms in adult tissues and cultured cells JOURNAL Arch. Biochem. Biophys. 390 (1), 71-77 (2001) PUBMED 11368517 REFERENCE 2 (bases 1 to 964) AUTHORS Cooley,B.C. and Bergtrom,G. TITLE Direct Submission JOURNAL Submitted (19-APR-2001) Orthopedic Surgery, Medical College of Wisconsin, 8701 Watertown Plank Rd., Milwaukee, WI 53226, USA FEATURES Location/Qualifiers source 1..964 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /tissue_type="brain" CDS 12..875 /note="contains exons 1a, 2b, 6b, and 9b; alternatively spliced" /codon_start=1 /product="tropomyosin alpha isoform" /protein_id="AAK54243.1" /translation="MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELV SLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRA QERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADR KYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKE DKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDKFLCFSPPKTPSSSRMSH LSELCICLLSS" ORIGIN 1 ccaccgccac catggacgcc atcaagaaga agatgcagat gctgaagctc gacaaagaga 61 acgccttgga tcgagcagag caggcggagg ctgacaagaa ggctgcggaa gacaggagca 121 agcagctgga agatgagctg gtgtcactgc aaaagaaact caagggcact gaagatgaac 181 tggacaaata ctccgaggct ctcaaagatg cccaggagaa actggagctg gcggagaaaa 241 aggccacaga tgctgaagct gacgtagcat ctctgaacag acgcatccag ctggttgagg 301 aggagttgga tcgcgctcag gagcgtctgg ccacagctct acagaagctg gaggaggctg 361 agaaggctgc agatgagagt gagagaggca tgaaagtcat tgaaagccga gcccaaaaag 421 atgaagaaaa gatggagatt caggagatcc agctgaaaga ggccaagcac attgctgaag 481 atgctgaccg aaagtatgaa gaggtggccc gtaagctggt catcatcgag agcgatctgg 541 agcgtgcgga ggagagggct gagctctcgg aaggcaaatg tgccgagctt gaagaagagt 601 tgaaaacggt gacgaacaac ttgaagtcac tggaggctca ggctgagaag tactctcaga 661 aagaagacaa gtatgaagag gagatcaagg ttctctctga caagctgaag gaggctgaga 721 cccgggctga gtttgcagag agatcagtaa ccaaattgga gaaaagcatt gatgacttag 781 aagataagtt tctttgcttc tctcctccca agactccttc atcaagccgg atgtcccacc 841 tctctgagct ctgcatctgt ctgctctcca gctgacccag gtttctttct agtgcccacc 901 caccctaggg ccaggcacag accgtgcttt ctattgtaca gaggtgatcc tcccagtgta 961 aaat //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on