Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_173856.2
FASTA Graphics
LOCUS NM_173856 1311 bp mRNA linear PRI 01-JUN-2024 DEFINITION Homo sapiens vomeronasal 1 receptor 2 (VN1R2), mRNA. ACCESSION NM_173856 VERSION NM_173856.2 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1311) AUTHORS Young,J.M., Massa,H.F., Hsu,L. and Trask,B.J. TITLE Extreme variability among mammalian V1R gene families JOURNAL Genome Res 20 (1), 10-18 (2010) PUBMED 19952141 REFERENCE 2 (bases 1 to 1311) AUTHORS Zhang,J. and Webb,D.M. TITLE Evolutionary deterioration of the vomeronasal pheromone transduction pathway in catarrhine primates JOURNAL Proc Natl Acad Sci U S A 100 (14), 8337-8341 (2003) PUBMED 12826614 REFERENCE 3 (bases 1 to 1311) AUTHORS Rodriguez,I. and Mombaerts,P. TITLE Novel human vomeronasal receptor-like genes reveal species-specific families JOURNAL Curr Biol 12 (12), R409-R411 (2002) PUBMED 12123587 REFERENCE 4 (bases 1 to 1311) AUTHORS Takeda,S., Kadowaki,S., Haga,T., Takaesu,H. and Mitaku,S. TITLE Identification of G protein-coupled receptor genes from the human genome sequence JOURNAL FEBS Lett 520 (1-3), 97-101 (2002) PUBMED 12044878 REMARK Erratum:[FEBS Lett 2002 Jul 17;523(1-3):257] COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC130356.1 and AC092070.2. On Aug 10, 2007 this sequence version replaced NM_173856.1. ##Evidence-Data-START## Transcript is intronless :: BC130356.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## MANE Ensembl match :: ENST00000341702.3/ ENSP00000351244.2 RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-61 BC130356.1 1-61 62-62 AC092070.2 116690-116690 63-195 BC130356.1 63-195 196-196 AC092070.2 116824-116824 197-1311 BC130356.1 197-1311 FEATURES Location/Qualifiers source 1..1311 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19q13.42" gene 1..1311 /gene="VN1R2" /gene_synonym="V1RL2" /note="vomeronasal 1 receptor 2" /db_xref="GeneID:317701" /db_xref="HGNC:HGNC:19872" exon 1..1311 /gene="VN1R2" /gene_synonym="V1RL2" /inference="alignment:Splign:2.1.0" misc_feature 64..66 /gene="VN1R2" /gene_synonym="V1RL2" /note="upstream in-frame stop codon" CDS 85..1272 /gene="VN1R2" /gene_synonym="V1RL2" /note="V1R-like 2; pheromone receptor; hGPCR25; V1r-like receptor 2; G-protein coupled receptor GPCR25" /codon_start=1 /product="vomeronasal type-1 receptor 2" /protein_id="NP_776255.2" /db_xref="CCDS:CCDS12862.1" /db_xref="GeneID:317701" /db_xref="HGNC:HGNC:19872" /translation="MTHTLYPTPFALYPINISAAWHLGPLPVSCFVSNKYQCSLAFGA TTGLRVLVVVVPQTQLSFLSSLCLVSLFLHSLVSAHGEKPTKPVGLDPTLFQVVVGIL GNFSLLYYYMFLYFRGYKPRSTDLILRHLTVADSLVILSKRIPETMATFGLKHFDNYF GCKFLLYAHRVGRGVSIGSTCLLSVFQVITINPRNSRWAEMKVKAPTYIGLSNILCWA FHMLVNAIFPIYTTGKWSNNNITKKGDLGYCSAPLSDEVTKSVYAALTSFHDVLCLGL MLWASSSIVLVLYRHKQQVQHICRNNLYPNSSPGNRAIQSILALVSTFALCYALSFIT YVYLALFDNSSWWLVNTAALIIACFPTISPFVLMCRDPSRSRLCSICCRRNRRFFHDF RKM" misc_feature 118..180 /gene="VN1R2" /gene_synonym="V1RL2" /note="propagated from UniProtKB/Swiss-Prot (Q8NFZ6.2); transmembrane region" misc_feature 238..300 /gene="VN1R2" /gene_synonym="V1RL2" /note="propagated from UniProtKB/Swiss-Prot (Q8NFZ6.2); transmembrane region" misc_feature 364..426 /gene="VN1R2" /gene_synonym="V1RL2" /note="propagated from UniProtKB/Swiss-Prot (Q8NFZ6.2); transmembrane region" misc_feature 595..657 /gene="VN1R2" /gene_synonym="V1RL2" /note="propagated from UniProtKB/Swiss-Prot (Q8NFZ6.2); transmembrane region" misc_feature 709..771 /gene="VN1R2" /gene_synonym="V1RL2" /note="propagated from UniProtKB/Swiss-Prot (Q8NFZ6.2); transmembrane region" misc_feature 799..801 /gene="VN1R2" /gene_synonym="V1RL2" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q8NFZ6.2); glycosylation site" misc_feature 886..948 /gene="VN1R2" /gene_synonym="V1RL2" /note="propagated from UniProtKB/Swiss-Prot (Q8NFZ6.2); transmembrane region" misc_feature 1033..1095 /gene="VN1R2" /gene_synonym="V1RL2" /note="propagated from UniProtKB/Swiss-Prot (Q8NFZ6.2); transmembrane region" misc_feature 1111..1113 /gene="VN1R2" /gene_synonym="V1RL2" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q8NFZ6.2); glycosylation site" misc_feature 1123..1185 /gene="VN1R2" /gene_synonym="V1RL2" /note="propagated from UniProtKB/Swiss-Prot (Q8NFZ6.2); transmembrane region" ORIGIN 1 tctctctctg ccttggctgc caggcaggga agggccccct gtccagtgga cacgtgaccc 61 acgtgacctt acctatcatt ggagatgact cacactcttt accctacccc ttttgctttg 121 tatccaataa atatcagcgc agcctggcat ttggggccac taccagtctc ctgctttgta 181 tccaataaat atcagtgcag cctggcattc ggggccacta ccggtctccg cgtcttggtg 241 gtagtggtcc cccagacaca gctgtctttt ctttcatctc tttgtcttgt gtctttattt 301 ctacactctc ttgtctctgc acacggagag aaacccacca aacctgtggg gctggaccct 361 acactattcc aggtagttgt tggaatcctg gggaattttt cactcttata ttattatatg 421 ttcctttact ttaggggata caagccaaga tccacagatt tgattctcag gcacctgact 481 gtagctgact ccttggttat cctatctaaa agaatcccag agaccatggc aacttttggg 541 ttgaaacatt ttgacaatta ttttggatgc aaatttcttt tgtatgcaca cagggtaggc 601 aggggtgtgt ccattggaag cacctgcctc ttgagtgtct tccaggtgat caccatcaac 661 cctaggaact ccaggtgggc agagatgaaa gtaaaagccc cgacatacat tggtctctcc 721 aatatcctgt gctgggcctt ccacatgctg gtaaatgcca tttttcctat ttatacaact 781 ggcaaatgga gcaacaacaa catcacaaag aaaggagatt tgggatattg ttctgcccca 841 cttagtgatg aagtcacaaa gtcagtatat gcagcattga catccttcca tgatgttttg 901 tgtctggggc tcatgctctg ggccagcagc tccatcgttt tggtcttgta caggcacaaa 961 cagcaggtac aacacatctg taggaacaat ctctacccca actcttctcc tgggaacaga 1021 gccatccaaa gcatccttgc attggtgagc acctttgcat tatgttacgc cctttccttc 1081 atcacctacg tttatttagc tctcttcgat aattccagtt ggtggctagt gaacactgct 1141 gcactaatca ttgcctgttt tccaactatt agcccttttg ttctcatgtg ccgtgacccc 1201 agcagatcca ggctctgcag tatctgctgc agaagaaata gacgattctt tcatgatttc 1261 aggaaaatgt gaattggctg tcttggttta tgttcggcca ctgatgcact c //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on