Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_076468.9
FASTA Graphics
LOCUS NM_076468 859 bp mRNA linear INV 04-DEC-2024 DEFINITION Caenorhabditis elegans MARVEL domain-containing protein (C42D8.1), mRNA. ACCESSION NM_076468 VERSION NM_076468.9 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 859) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 859) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 859) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (17-OCT-2024) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 859) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003284). On May 27, 2020 this sequence version replaced NM_076468.8. FEATURES Location/Qualifiers source 1..859 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="X" gene 1..859 /gene="C42D8.1" /locus_tag="CELE_C42D8.1" /db_xref="GeneID:180782" /db_xref="WormBase:WBGene00016599" CDS 5..763 /gene="C42D8.1" /locus_tag="CELE_C42D8.1" /standard_name="C42D8.1" /note="Confirmed by transcript evidence" /codon_start=1 /product="MARVEL domain-containing protein" /protein_id="NP_508869.2" /db_xref="GeneID:180782" /db_xref="WormBase:WBGene00016599" /translation="MSMYGKDKAYIENETKFRADRDYLSQPVYQQTVYREGPILKPDV EVSVVDVEPVECTPHMWGHPMGLLRWFQLLMFFVLQWLVQITCGGDACTMIMNVFGYT AMGQLFVLVIFLGLSMFCGVIILLFALNAHRCIPSIIIALEKVYAILGIVFMFIAGIL GTWMAVLANDREVNYQGRGRGHIQGQWIAAAVLEFLMVIVYIFDFILQRRENYPFTGK EYKTVPSQQTGPGSMRSTTTNTKRSTDFIFQETF" ORIGIN 1 aaccatgtcg atgtatggca aagacaaggc gtatatcgag aatgagacaa agtttcgagc 61 agacagagat tacttgagcc agcctgtcta tcaacaaact gtctatcgag aaggcccaat 121 tttgaaacca gatgtagagg tttcagtggt agacgttgaa cccgtcgagt gtactcctca 181 catgtggggt catccgatgg gacttttgag gtggttccaa ttgctcatgt tttttgtgct 241 tcaatggctg gtgcagatca cttgcggagg ggatgcatgc accatgatta tgaatgtttt 301 tggatatact gccatggggc agctctttgt gctggtaata ttccttggac tatctatgtt 361 ttgtggtgtc atcatccttc ttttcgctct taacgctcat cgttgcattc catccatcat 421 catcgcactg gagaaggtat atgcgatcct tggaattgtg ttcatgttta tcgctggaat 481 cttgggaacc tggatggcag ttttggcaaa cgacagggaa gtaaactatc agggaagagg 541 acgaggtcac attcaaggac aatggattgc tgccgcggta ctcgagttcc tgatggtcat 601 tgtctacatc tttgatttca tcctgcagcg ccgtgaaaac tatcccttca ctggaaagga 661 atacaaaacc gtcccgtcac agcaaacggg accgggctcg atgcgttcga caacgaccaa 721 tacaaagcga tctactgatt tcattttcca agaaactttc taattctgac cgtcttcttc 781 tttcaaaaaa aaaaaacgtt gtaatgtgca attttgattt ctctttcttt catcattatt 841 actaaatgtt tcctgtatt //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on