Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: M87268.1
FASTA Graphics
LOCUS HUMIGMVDJ 363 bp mRNA linear PRI 15-DEC-1993 DEFINITION Human IgM VDJ-region mRNA, complete cds. ACCESSION M87268 VERSION M87268.1 KEYWORDS diversity region; immunoglobulin; immunoglobulin heavy chain; immunoglobulin mu-chain; joining region; rheumatoid factor; variable region; variable region subgroup VH-III. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 363) AUTHORS Knight,G.B., Agnello,V., Bonagura,V., Barnes,J.L., Panka,D.J. and Zhang,Q.X. TITLE Human rheumatoid factor cross-idiotypes. IV. Studies on WA XId-positive IgM without rheumatoid factor activity provide evidence that the WA XId is not unique to rheumatoid factors and is distinct from the 17.109 and G6 XIds JOURNAL J. Exp. Med. 178 (6), 1903-1911 (1993) PUBMED 8245772 REFERENCE 2 (bases 1 to 363) AUTHORS Knight,G.B. TITLE Direct Submission JOURNAL Submitted (28-FEB-1992) Glenn Knight, Department of Immunology Research and Molecular Biology, Lahey Clinic Medical Center, 41 Mall Road, Burlington, MA 01805 USA COMMENT Original source text: Homo sapiens cDNA to mRNA. FEATURES Location/Qualifiers source 1..363 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /sex="male" gene 1..363 /gene="IGHM" mRNA 1..363 /gene="IGHM" /product="IgM" /experiment="experimental evidence, no additional details recorded" CDS 1..363 /gene="IGHM" /note="putative" /codon_start=1 /product="IgM" /protein_id="AAC37536.1" /translation="EVQLLESGGGLVQPGGSLRLSCTASGFTFSTYGMSWVRQAPGKG LEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAAPRH AGSPPYDYWGQGTLVTVSS" ORIGIN 1 gaggtgcagc tgttggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 61 tcctgtacag cctctggatt cacctttagc acctatggca tgagctgggt ccgccaggct 121 ccagggaagg ggctggagtg ggtctcagct attagtggta gtggtggtag cacatattac 181 gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat 241 ctgcaaatga acagcctgag agccgaggac acggccgtct attactgtgc ggccgcccca 301 agacatgcgg ggagtccccc ctatgactac tggggccagg gaaccctggt caccgtctcc 361 tca //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on