U.S. flag

An official website of the United States government

Homo sapiens N-myc and STAT interactor (NMI), mRNA

NCBI Reference Sequence: NM_004688.2

FASTA Graphics 

LOCUS       NM_004688               1501 bp    mRNA    linear   PRI 04-MAY-2019
DEFINITION  Homo sapiens N-myc and STAT interactor (NMI), mRNA.
ACCESSION   NM_004688
VERSION     NM_004688.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1501)
  AUTHORS   Yu F, Tian T, Deng B, Wang T, Qi Q, Zhu M, Yan C, Ding H, Wang J,
            Dai J, Ma H, Ding Y and Jin G.
  TITLE     Multi-marker analysis of genomic annotation on gastric cancer GWAS
            data from Chinese populations
  JOURNAL   Gastric Cancer 22 (1), 60-68 (2019)
   PUBMED   29859005
  REMARK    GeneRIF: NMI and RAC1 might represent two new key genes related to
            gastric cancer
REFERENCE   2  (bases 1 to 1501)
  AUTHORS   Pruitt HC, Metge BJ, Weeks SE, Chen D, Wei S, Kesterson RA, Shevde
            LA and Samant RS.
  TITLE     Conditional knockout of N-Myc and STAT interactor disrupts normal
            mammary development and enhances metastatic ability of mammary
            tumors
  JOURNAL   Oncogene 37 (12), 1610-1623 (2018)
   PUBMED   29326438
  REMARK    GeneRIF: Nmi has a distinct role in the differentiation process of
            mammary luminal epithelial cell compartment and developmental
            aberrations resulting from Nmi absence contribute to metastasis.
REFERENCE   3  (bases 1 to 1501)
  AUTHORS   Song D, Zhao J, Su C, Jiang Y and Hou J.
  TITLE     Etoposide induced NMI promotes cell apoptosis by activating the
            ARF-p53 signaling pathway in lung carcinoma
  JOURNAL   Biochem. Biophys. Res. Commun. 495 (1), 368-374 (2018)
   PUBMED   29030066
  REMARK    GeneRIF: These investigations demonstrated etoposide-induced NMI
            can suppress tumor proliferation and promote cell apoptosis by
            activating the ARF-p53 signaling pathway in lung carcinoma. Our
            results provide an alternative mechanism for etoposide in lung
            carcinoma and suggest NMI has a critical role in suppressing lung
            carcinoma progression.
REFERENCE   4  (bases 1 to 1501)
  AUTHORS   Xiahou Z, Wang X, Shen J, Zhu X, Xu F, Hu R, Guo D, Li H, Tian Y,
            Liu Y and Liang H.
  TITLE     NMI and IFP35 serve as proinflammatory DAMPs during cellular
            infection and injury
  JOURNAL   Nat Commun 8 (1), 950 (2017)
   PUBMED   29038465
  REMARK    GeneRIF: Damage-associated molecular patterns (DAMP) are important
            mediators of innate immunity. Here the authors show that N-myc and
            STAT interactor (NMI) and interferon-induced protein 35 (IFP35) act
            as DAMPs to promote inflammation by activating macrophages via the
            Toll-like receptor 4 and NF-kappaB pathways.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1501)
  AUTHORS   Wang J, Zou K, Feng X, Chen M, Li C, Tang R, Xuan Y, Luo M, Chen W,
            Qiu H, Qin G, Li Y, Zhang C, Xiao B, Kang L, Kang T, Huang W, Yu X,
            Wu X and Deng W.
  TITLE     Downregulation of NMI promotes tumor growth and predicts poor
            prognosis in human lung adenocarcinomas
  JOURNAL   Mol. Cancer 16 (1), 158 (2017)
   PUBMED   29025423
  REMARK    GeneRIF: Our study showed that NMI suppressed tumor growth by
            inhibiting PI3K/AKT, MMP2/MMP9, COX-2/PGE2 signaling pathways and
            p300-mediated NF-kappaB acetylation, and predicted a favorable
            prognosis in human lung adenocarcinomas, suggesting that NMI was a
            potential tumor suppressor in lung cancer.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1501)
  AUTHORS   Bannasch D, Weis I and Schwab M.
  TITLE     Nmi protein interacts with regions that differ between MycN and Myc
            and is localized in the cytoplasm of neuroblastoma cells in
            contrast to nuclear MycN
  JOURNAL   Oncogene 18 (48), 6810-6817 (1999)
   PUBMED   10597290
REFERENCE   7  (bases 1 to 1501)
  AUTHORS   Lee ND, Chen J, Shpall RL and Naumovski L.
  TITLE     Subcellular localization of interferon-inducible
            Myc/stat-interacting protein Nmi is regulated by a novel IFP 35
            homologous domain
  JOURNAL   J. Interferon Cytokine Res. 19 (11), 1245-1252 (1999)
   PUBMED   10574616
REFERENCE   8  (bases 1 to 1501)
  AUTHORS   Zhu M, John S, Berg M and Leonard WJ.
  TITLE     Functional association of Nmi with Stat5 and Stat1 in IL-2- and
            IFNgamma-mediated signaling
  JOURNAL   Cell 96 (1), 121-130 (1999)
   PUBMED   9989503
REFERENCE   9  (bases 1 to 1501)
  AUTHORS   Lebrun SJ, Shpall RL and Naumovski L.
  TITLE     Interferon-induced upregulation and cytoplasmic localization of
            Myc-interacting protein Nmi
  JOURNAL   J. Interferon Cytokine Res. 18 (9), 767-771 (1998)
   PUBMED   9781816
REFERENCE   10 (bases 1 to 1501)
  AUTHORS   Bao J and Zervos AS.
  TITLE     Isolation and characterization of Nmi, a novel partner of Myc
            proteins
  JOURNAL   Oncogene 12 (10), 2171-2176 (1996)
   PUBMED   8668343
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CB151555.1, BC001268.1 and
            BC021987.2.
            
            [WARNING] On May 17, 2019 this sequence was replaced by
            NM_004688.3.
            
            On May 15, 2008 this sequence version replaced NM_004688.1.
            
            Summary: NMYC interactor (NMI) encodes a protein that interacts
            with NMYC and CMYC (two members of the oncogene Myc family), and
            other transcription factors containing a Zip, HLH, or HLH-Zip
            motif. The NMI protein also interacts with all STATs except STAT2
            and augments STAT-mediated transcription in response to cytokines
            IL2 and IFN-gamma. The NMI mRNA has low expression levels in all
            human fetal and adult tissues tested except brain and has high
            expression in cancer cell line-myeloid leukemias. [provided by
            RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC001268.1, AK291548.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000350]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-280               CB151555.1         1-280
            281-596             BC001268.1         1-316
            597-831             BC021987.2         273-507
            832-1501            BC001268.1         552-1221
FEATURES             Location/Qualifiers
     source          1..1501
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2q23.3"
     gene            1..1501
                     /gene="NMI"
                     /note="N-myc and STAT interactor"
                     /db_xref="GeneID:9111"
                     /db_xref="HGNC:HGNC:7854"
                     /db_xref="MIM:603525"
     exon            1..324
                     /gene="NMI"
                     /inference="alignment:Splign:2.1.0"
     exon            325..411
                     /gene="NMI"
                     /inference="alignment:Splign:2.1.0"
     CDS             331..1254
                     /gene="NMI"
                     /codon_start=1
                     /product="N-myc-interactor"
                     /protein_id="NP_004679.2"
                     /db_xref="CCDS:CCDS2192.1"
                     /db_xref="GeneID:9111"
                     /db_xref="HGNC:HGNC:7854"
                     /db_xref="MIM:603525"
                     /translation="MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEI
                     QKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQK
                     GQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKIN
                     VTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILK
                     KKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLI
                     NIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE"
     misc_feature    376..378
                     /gene="NMI"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (Q13287.2);
                     phosphorylation site"
     exon            412..507
                     /gene="NMI"
                     /inference="alignment:Splign:2.1.0"
     exon            508..670
                     /gene="NMI"
                     /inference="alignment:Splign:2.1.0"
     exon            671..777
                     /gene="NMI"
                     /inference="alignment:Splign:2.1.0"
     exon            778..964
                     /gene="NMI"
                     /inference="alignment:Splign:2.1.0"
     exon            965..1071
                     /gene="NMI"
                     /inference="alignment:Splign:2.1.0"
     exon            1072..1479
                     /gene="NMI"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1458..1463
                     /regulatory_class="polyA_signal_sequence"
                     /gene="NMI"
     polyA_site      1479
                     /gene="NMI"
ORIGIN      
        1 ctgttagtga ctaatcattg gagacaacca tgtttagtat ttgagcattg gttaaatgct
       61 aaagaaaaat cgccgttaaa gcagttttct ttttcactgt ctttttcttt tcgcggggaa
      121 cccagctgtt cctgcgaggg ccacctcctc aggaagaccc cgcagctctc ccgcggcgct
      181 tctgcaggag gcagcgacag tttcgagaac ccgggccttc ccctcccagt gcctcccggg
      241 gttccggcgt ttcaggcgct gctgttttcc gggaagggca ggcgcgctgg gccttgggga
      301 gctgcgctcg gcgggcggac gcgggggatc atggaagctg ataaagatga cacacaacaa
      361 attcttaagg agcattcgcc agatgaattt ataaaagatg aacaaaataa gggactaatt
      421 gatgaaatta caaagaaaaa tattcaacta aagaaggaga tccaaaagct tgaaacggag
      481 ttacaagagg ctaccaaaga attccagatt aaagaggata ttcctgaaac aaagatgaaa
      541 ttcttatcag ttgaaactcc tgagaatgac agccagttgt caaatatctc ctgttcgttt
      601 caagtgagct cgaaagttcc ttatgagata caaaaaggac aagcacttat cacctttgaa
      661 aaagaagaag ttgctcaaaa tgtggtaagc atgagtaaac atcatgtaca gataaaagat
      721 gtaaatctgg aggttacggc caagccagtt ccattaaatt caggagtcag attccaggtt
      781 tatgtagaag tttctaaaat gaaaatcaat gttactgaaa ttcctgacac attgcgtgaa
      841 gatcaaatga gagacaaact agagctgagc ttttcaaagt cccgaaatgg aggcggagag
      901 gtggaccgcg tggactatga cagacagtcc gggagtgcag tcatcacgtt tgtggagatt
      961 ggagtggctg acaagatttt gaaaaagaaa gaataccctc tttatataaa tcaaacctgc
     1021 catagagtta ctgtttctcc atacacagaa atacacttga aaaagtatca gatattttca
     1081 ggaacatcta agaggacagt gcttctgaca ggaatggaag gcattcaaat ggatgaagaa
     1141 attgtggagg atttaattaa cattcacttt caacgggcaa agaatggagg tggagaagta
     1201 gatgtggtca agtgttctct aggtcaacct cacatagcat actttgaaga atagacttaa
     1261 cagaatcatg aaaactatag ctttttaacc cggattactg taaatgtttg acaaaaatga
     1321 atatgctttt ccttaaaaaa tgaaaacttt aatttttacc atccatttat gtttagatac
     1381 aaaacttatt tccatgtttc tgaatcttct ttgtttcaaa tggtgctgca tgttttcaac
     1441 tacaataagt gcactgtaat aaaaagtttt gtttatagaa aaaaaaaaaa aaaaaaaaaa
     1501 a
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.