Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_065206.6
FASTA Graphics
LOCUS NM_065206 1270 bp mRNA linear INV 04-DEC-2024 DEFINITION Caenorhabditis elegans Cyclin N-terminal domain-containing protein (cosa-1), mRNA. ACCESSION NM_065206 VERSION NM_065206.6 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 1270) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 1270) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1270) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (17-OCT-2024) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 1270) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003281). On Feb 2, 2021 this sequence version replaced NM_065206.5. FEATURES Location/Qualifiers source 1..1270 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="III" gene 1..1270 /gene="cosa-1" /locus_tag="CELE_Y71H2AM.7" /db_xref="GeneID:175388" /db_xref="WormBase:WBGene00022172" CDS 51..1133 /gene="cosa-1" /locus_tag="CELE_Y71H2AM.7" /standard_name="Y71H2AM.7" /note="Confirmed by transcript evidence" /codon_start=1 /product="Cyclin N-terminal domain-containing protein" /protein_id="NP_497607.3" /db_xref="GeneID:175388" /db_xref="WormBase:WBGene00022172" /translation="MSSSRSHRKNTSTLGTPAVSAANQTVKNPNLKKNEPKSDNEPPK TLVSMEPDFYDPRGACHMIYWTDCIAQMAVDIRERQNAANQSDFDFMKPKLVEYVFTV CVRLRLPNEVRFTAALILNSFMLRHLCSLHDFMERQEMSIQRKKREWENLESNMERQI PLRILTAIQISSKFHSYHDSLSSRQVVNTLRKIGLPYTISAVLESEQRVFKLIGFKMP DSPLDACEMALKVLTFTMKKRGMIDEEKYNDLWQHTLIVLDVCFINHIELYERFIRKC PAICRTEERLNISKFKWDIQLLAAATVQTAYILLLGTSQIANVSVIINNLLRCDNAYV EPLKQSIIELACAKKNESIPECSTSS" ORIGIN 1 aaaaatcgac aaaatcagtg aaaaatcgtg aaaactgaac tgaagtgtca atgtcaagtt 61 ctcggtcaca ccgcaaaaac acttcaactc taggtacacc tgccgtatca gcagcgaatc 121 agaccgtaaa aaatccgaat ctgaagaaaa atgagccaaa aagcgacaat gagccaccga 181 aaacgctggt ttcaatggaa cctgattttt atgaccctcg gggagcgtgt catatgattt 241 attggacgga ttgcattgca caaatggctg ttgatattcg agagcgtcaa aacgccgcaa 301 atcagagtga tttcgatttt atgaagccaa aacttgttga atacgttttc acagtttgcg 361 tcaggttacg gctgcccaat gaggttcgat tcaccgccgc gttgatctta aattctttca 421 tgctccgcca cctgtgctct ctgcacgatt tcatggaacg acaagaaatg tcgattcaac 481 ggaagaaaag agaatgggaa aatcttgaat cgaatatgga acgacagatt ccgttgagaa 541 ttctaactgc aattcagatt agcagcaaat ttcacagtta tcatgatagt ctatcgtctc 601 gtcaagttgt gaatactcta cgaaaaatcg gcctaccgta cacaatatcc gctgttttgg 661 aatcggagca acgcgttttt aagctcatcg gattcaaaat gcctgacagt ccactagatg 721 catgtgaaat ggctctaaaa gtgctcacat ttacaatgaa aaagcgtgga atgattgacg 781 aggagaaata taatgatcta tggcaacata cattaattgt attagatgtc tgttttatta 841 atcatatcga attatacgaa cgatttattc gaaagtgtcc ggcgatttgt agaacggagg 901 aaagattaaa catctcaaaa ttcaaatggg atatccaatt gctcgccgcc gcaaccgtcc 961 aaactgctta cattctactt ctcggcactt ctcaaattgc caatgtttca gtgataatca 1021 ataatttatt gagatgtgac aatgcttatg tcgaaccatt aaagcaatcg attatagagc 1081 tcgcctgcgc gaaaaagaat gagagtattc cggaatgcag cacctcctcg taactaccat 1141 ctctgacagc acctctttgt cgccgattcc actggtcgcg gctcgttcac tgcaacaaat 1201 tattgatttt tattgtcatg taccatattg aatgcataat gtttaattta ataaatttgg 1261 atttagtttt //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on