LOCUS NM_053894 1762 bp mRNA linear ROD 31-MAR-2024
DEFINITION Rattus norvegicus Jun dimerization protein 2 (Jdp2), mRNA.
ACCESSION NM_053894
VERSION NM_053894.3
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1762)
AUTHORS Nakane,T., Matsumoto,S., Iida,S., Ido,A., Fukunaga,K., Murao,K. and
Sugiyama,Y.
TITLE Candidate plasticity gene 16 and jun dimerization protein 2 are
involved in the suppression of insulin gene expression in rat
pancreatic INS-1 beta-cells
JOURNAL Mol Cell Endocrinol 527, 111240 (2021)
PUBMED 33676985
REMARK GeneRIF: Candidate plasticity gene 16 and jun dimerization protein
2 are involved in the suppression of insulin gene expression in rat
pancreatic INS-1 beta-cells.
REFERENCE 2 (bases 1 to 1762)
AUTHORS Kimura,M.
TITLE IRF2-binding protein-1 is a JDP2 ubiquitin ligase and an inhibitor
of ATF2-dependent transcription
JOURNAL FEBS Lett 582 (19), 2833-2837 (2008)
PUBMED 18671972
REFERENCE 3 (bases 1 to 1762)
AUTHORS Nakade,K., Pan,J., Yoshiki,A., Ugai,H., Kimura,M., Liu,B., Li,H.,
Obata,Y., Iwama,M., Itohara,S., Murata,T. and Yokoyama,K.K.
TITLE JDP2 suppresses adipocyte differentiation by regulating histone
acetylation
JOURNAL Cell Death Differ 14 (8), 1398-1405 (2007)
PUBMED 17464331
REFERENCE 4 (bases 1 to 1762)
AUTHORS Wardell,S.E., Kwok,S.C., Sherman,L., Hodges,R.S. and Edwards,D.P.
TITLE Regulation of the amino-terminal transcription activation domain of
progesterone receptor by a cofactor-induced protein folding
mechanism
JOURNAL Mol Cell Biol 25 (20), 8792-8808 (2005)
PUBMED 16199860
REMARK GeneRIF: JDP-2 enhances transcriptional activity of progesterone
receptor through a protein folding mechanism by an interdomain
communication.
REFERENCE 5 (bases 1 to 1762)
AUTHORS Jin,C., Ugai,H., Song,J., Murata,T., Nili,F., Sun,K., Horikoshi,M.
and Yokoyama,K.K.
TITLE Identification of mouse Jun dimerization protein 2 as a novel
repressor of ATF-2
JOURNAL FEBS Lett 489 (1), 34-41 (2001)
PUBMED 11231009
REFERENCE 6 (bases 1 to 1762)
AUTHORS Aronheim,A., Zandi,E., Hennemann,H., Elledge,S.J. and Karin,M.
TITLE Isolation of an AP-1 repressor by a novel method for detecting
protein-protein interactions
JOURNAL Mol Cell Biol 17 (6), 3094-3102 (1997)
PUBMED 9154808
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
JAXUCZ010000006.1.
On Feb 7, 2022 this sequence version replaced NM_053894.2.
##Evidence-Data-START##
Transcript exon combination :: SRR23984936.1092419.1,
SRR21887623.2265945.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA5760386, SAMEA5760393
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on conservation, expression
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-216 JAXUCZ010000006.1 110993591-110993806
217-449 JAXUCZ010000006.1 111002382-111002614
450-554 JAXUCZ010000006.1 111027043-111027147
555-1762 JAXUCZ010000006.1 111032185-111033392
FEATURES Location/Qualifiers
source 1..1762
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="BN"
/db_xref="taxon:10116"
/chromosome="6"
/map="6q31"
gene 1..1762
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/note="Jun dimerization protein 2"
/db_xref="GeneID:116674"
/db_xref="RGD:621611"
exon 1..216
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/inference="alignment:Splign:2.1.0"
exon 217..449
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/inference="alignment:Splign:2.1.0"
CDS 249..740
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/codon_start=1
/product="jun dimerization protein 2"
/protein_id="NP_446346.1"
/db_xref="GeneID:116674"
/db_xref="RGD:621611"
/translation="MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIG
AMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQR
ESERLELMNAELKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQL
DKK"
misc_feature 249..308
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/note="propagated from UniProtKB/Swiss-Prot (Q78E65.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 423..515
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/note="propagated from UniProtKB/Swiss-Prot (Q78E65.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 468..536
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/note="propagated from UniProtKB/Swiss-Prot (Q78E65.1);
Region: Basic motif.
/evidence=ECO:0000255|PROSITE-ProRule:PRU00978"
misc_feature 546..632
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/note="propagated from UniProtKB/Swiss-Prot (Q78E65.1);
Region: Leucine-zipper.
/evidence=ECO:0000255|PROSITE-ProRule:PRU00978"
misc_feature 690..692
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/note="Phosphothreonine, by MAPK8.
/evidence=ECO:0000250|UniProtKB:Q8WYK2; propagated from
UniProtKB/Swiss-Prot (Q78E65.1); phosphorylation site"
exon 450..554
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/inference="alignment:Splign:2.1.0"
exon 555..1762
/gene="Jdp2"
/gene_synonym="Jundm2; Jundp2"
/inference="alignment:Splign:2.1.0"
ORIGIN
1 gccgcccgcc acagcctgcg ggagggactc tcggcggccg cgacgggggg cactggcggc
61 ggcgggcgct gcagcggcgg cggcggggct ggcgccgcgg cggctcccgg gccgggacgg
121 gcctgggcag cgggcggcag cagcgcggag agggcacggc gcctgcagca gggttctggg
181 cccggggccg ccgcctccgc cagcggcttc tgcacgcccc tccaggccgg cctgccactc
241 ctcctgctat gatgcctggg cagatcccag acccttcagt gaccgcaggc tctctgccag
301 ggctcggccc cctcaccgga cttcccagct ctgctctgac cacagaggag ctgaaatacg
361 ctgacatccg caacattggg gcgatgattg cgcccttgca cttcctggag gtgaaactgg
421 gcaagaggcc ccaacccgtg aagagtgagc tagatgagga agaagagcga aggaaaaggc
481 gccgggagaa gaacaaagtt gctgcagcca gatgccggaa caagaagaag gagcgcacgg
541 agttcctgca gagggagtca gagaggctgg agctcatgaa cgcagagcta aagacccaga
601 tagaggagct gaagcttgag aggcagcagc tgatcctgat gctcaaccgc caccggccca
661 cctgtatcgt gcgtacagac agcgtcagga cgccggagtc ggaaggcaac ccgctgctgg
721 agcagctgga caagaagtga ctgaaagcct ggaggaggca gcggaggaag aggaggaaga
781 ggaggagcag caaagaggag gaggagcaaa gtgatggagg gcccctcccg ggcacgtgac
841 aaactctatg atgaggctta gcataactgg cctccagctg gctctttttg gaaactcagc
901 ccagccgcac aagagcaaga gcggactgaa gaaaccagag ggaccaggtg ctgagaccaa
961 ggttgacccg cagatagggg ctgccccact ccagggccca acttgaaggg cacctaagcc
1021 ggagaggtgc caaaccaggt agccaccttg ggctctctcc gccaagactc ccacccaggg
1081 gactacggag cagccaagaa aagccatgca ttgcaaacac agtgtggccg aggatggagc
1141 tcagcggagt ctgtaatcca ccttccccag ccctgcccaa gcccggtgga aagggggtgc
1201 actgtggggc tgcgatggcc cagctggagt ttgctgaggc actgaggcgc gggcgccctt
1261 ccaaagcaca cacccaatca atgaatgttt acagactggc tgtcctggcg gggcttccaa
1321 ctgcacacgg tttttttata ctttctttct ttcttttttt tttttttaat attttttaca
1381 aaaaaaagat tttatacgag caatatatat atgtggattt ctataatcac tcgatgtgac
1441 acagtacaaa tatgctatgg tctgctgtta cagccattgt aattcctaag tactgtaggc
1501 tctgggtgtt gggggggtag ccaggcgggt ggggtacatt tccatccttg taaccccttc
1561 ctagtactca gtcctgtatc gctcagtaaa cattgctctt aattacccag ctgcctcgag
1621 tggtgtctgc ccagggagag ggcatgccca gggcagatgt ttgggaagag tttccaaacc
1681 tgccctacca agtaagcctg aatatgccca tttcacagat gaggagtctg aggcctagag
1741 atgttaaaga actctgcaca ta
//