Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: HF583571.1
FASTA Graphics
LOCUS HF583571 144 bp DNA linear PRI 25-SEP-2013 DEFINITION Homo sapiens UNC13C gene for alternative protein UNC13C, isolate 92114. ACCESSION HF583571 VERSION HF583571.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 AUTHORS Vanderperre,B., Lucier,J.F., Bissonnette,C., Motard,J., Tremblay,G., Vanderperre,S., Wisztorski,M., Salzet,M., Boisvert,F.M. and Roucou,X. TITLE Direct detection of alternative open reading frames translation products in human significantly expands the proteome JOURNAL PLoS ONE 8 (8), E70698 (2013) PUBMED 23950983 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 144) AUTHORS Vanderperre,B. TITLE Direct Submission JOURNAL Submitted (14-JAN-2013) Biochemistry, University of Sherbrooke, 3201 Jean Migneault, J1E 4K8, CANADA FEATURES Location/Qualifiers source 1..144 /organism="Homo sapiens" /mol_type="genomic DNA" /db_xref="taxon:9606" gene 1..144 /gene="UNC13C" CDS 1..144 /gene="UNC13C" /codon_start=1 /product="alternative protein UNC13C" /protein_id="CCQ43068.1" /db_xref="UniProtKB/TrEMBL:L8E9P5" /translation="MSQVPHLTLMSTRSPITIKQRMRKIILNQWLTMKQIMLKSWNKS LLN" ORIGIN 1 atgagtcaag taccacactt gactctgatg tctacacgga gccctattac tataaagcag 61 aggatgagga agattatact gaaccagtgg ctgacaatga aacagattat gttgaagtca 121 tggaacaagt ccttgctaaa ctag //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on