Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: KF772696.1
FASTA Graphics PopSet
LOCUS KF772696 249 bp DNA linear PRI 05-NOV-2015 DEFINITION Homo sapiens isolate 15E9 thyroid hormone receptor alpha 1 (THRA) gene, exon 9 and partial cds. ACCESSION KF772696 VERSION KF772696.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 249) AUTHORS Kalikiri,M.K. and Rajesh,V. TITLE Identification and analysis of novel Polymorphisms in the conserved C-terminal domain of Thyroid hormone receptors in Patients with Autism JOURNAL Unpublished REFERENCE 2 (bases 1 to 249) AUTHORS Kalikiri,M.K. and Rajesh,V. TITLE Direct Submission JOURNAL Submitted (28-OCT-2013) Biological Science, BITS Pilani Hyderabad Campus, Jawahar Nagar, Shameerpet, Hyderabad, Andhra Pradesh 500078, India COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..249 /organism="Homo sapiens" /mol_type="genomic DNA" /isolate="15E9" /db_xref="taxon:9606" gene <1..>249 /gene="THRA" mRNA <1..>249 /gene="THRA" /product="thyroid hormone receptor alpha 1" CDS <1..249 /gene="THRA" /codon_start=1 /product="thyroid hormone receptor alpha 1" /protein_id="AIW04497.1" /translation="RSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVT DLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV" exon <1..>249 /gene="THRA" /number=9 ORIGIN 1 cgctcgggcc tgctgtgtgt ggacaagatc gagaagagtc aggaggcgta cctgctggcg 61 ttcgagcact acgtcaacca ccgcaaacac aacattccgc acttctggcc caagctgctg 121 atgaaggtga ctgacctccg catgatcggg gcctgccacg ccagccgctt cctccacatg 181 aaagtcgagt gccccaccga actcttcccc ccactcttcc tcgaggtctt tgaggatcag 241 gaagtctaa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on