Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AF199336.1
FASTA Graphics
LOCUS AF199336 798 bp mRNA linear ROD 26-JUL-2016 DEFINITION Rattus norvegicus RIM binding protein 2 (Rbp2) mRNA, partial cds. ACCESSION AF199336 VERSION AF199336.1 KEYWORDS . SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 798) AUTHORS Wang,Y., Sugita,S. and Sudhof,T.C. TITLE The RIM/NIM family of neuronal C2 domain proteins. Interactions with Rab3 and a new class of Src homology 3 domain proteins JOURNAL J. Biol. Chem. 275 (26), 20033-20044 (2000) PUBMED 10748113 REFERENCE 2 (bases 1 to 798) AUTHORS Wang,Y. and Sudhof,T.C. TITLE Direct Submission JOURNAL Submitted (27-OCT-1999) Center for Basic Neuroscience, The University of Texas Southwestern Medical Center, 6000 Harry Hines Blvd., Dallas, TX 75235-9111, USA FEATURES Location/Qualifiers source 1..798 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" gene <1..798 /gene="Rbp2" CDS <1..798 /gene="Rbp2" /note="RBP2" /codon_start=1 /product="RIM binding protein 2" /protein_id="AAF81658.1" /translation="ILGNSALMGRGDRMEHVSRRYSHSGGGPQRHRPMAPSIDEYTGR DHLSPDFYDESETDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVY GDKDADGFYRGETCARLGLIPCNMVSEIHADDEEMMDQLLRQGFLPLNTPVEKIERSR RSGRGHSVPTRRMVALYDYDPRESSPNVDVEAELLFCTGDIITVFGEIDEDGFYYGEL NGQKGLVPSNFLEEVPDDVEVHLSDAPPHYSHDPPMRTKAKRVSQPP" ORIGIN 1 attttaggaa actccgcctt gatgggacga ggagaccgga tggagcatgt gagccgaagg 61 tattcgcaca gcggcggagg tcctcagaga cataggccga tggctccatc cattgatgaa 121 tacacggggc gagaccatct ttctccagac ttctatgacg agtcagaaac ggaccccggt 181 gctgaggagc tcccggcccg catcttcgtt gctctgtttg actatgaccc gctcaccatg 241 tccccaaacc cggatgctgc cgaagaggag ctgcccttca aagaaggaca gatcatcaag 301 gtatatggag acaaagacgc agatggcttc taccgtgggg agacctgtgc caggctcggc 361 ctcattccct gtaacatggt ctccgagatc catgcggatg atgaggagat gatggaccag 421 ctgctgagac aaggcttcct ccctctgaac acacccgtgg agaaaataga gagaagtaga 481 agaagcggcc ggggtcactc tgtacccaca cggagaatgg tggctctcta cgactatgac 541 cctcgggaaa gctcccctaa cgtggacgtt gaggctgaac ttctgttttg cacaggagac 601 attattactg tttttggtga aatcgatgaa gacgggtttt attacggaga gctgaatggg 661 cagaaaggcc tcgtgccttc caatttcctg gaagaagtgc ctgatgacgt ggaggtccac 721 ctttccgatg ctccgcccca ctactcccac gacccgccca tgcgcaccaa ggccaaaagg 781 gtaagccagc ccccttag //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on