U.S. flag

An official website of the United States government

Mus musculus protein tyrosine phosphatase STEP38 mRNA, complete cds

GenBank: U28216.1

FASTA Graphics 

LOCUS       MMU28216                1874 bp    mRNA    linear   ROD 13-DEC-2001
DEFINITION  Mus musculus protein tyrosine phosphatase STEP38 mRNA, complete
            cds.
ACCESSION   U28216
VERSION     U28216.1
KEYWORDS    .
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1874)
  AUTHORS   Bult,A., Zhao,F., Dirkx,R. Jr., Raghunathan,A., Solimena,M. and
            Lombroso,P.J.
  TITLE     STEP: a family of brain-enriched PTPs. Alternative splicing
            produces transmembrane, cytosolic and truncated isoforms
  JOURNAL   Eur. J. Cell Biol. 72 (4), 337-344 (1997)
   PUBMED   9127733
REFERENCE   2  (bases 1 to 1874)
  AUTHORS   Lombroso,P.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUN-1995) Paul J. Lombroso, Child Study Center, Yale
            University School of Medicine, 230 South Frontage Road, New Haven,
            CT 06520, USA
FEATURES             Location/Qualifiers
     source          1..1874
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="BALB/c"
                     /db_xref="taxon:10090"
                     /clone_lib="brain cDNA lambda gt11 library from Clontech
                     (ML1042b)"
                     /dev_stage="adult"
     CDS             235..1275
                     /note="alternative spliced member of the STEP family of
                     PTPs; STEP38 is a truncated form of STEP61; a new stop
                     codon is introduced through a retained intron; the new
                     stop codon is upstream of the conserved phosphatase
                     domain, thus STEP38 lacks a phosphatase domain and is
                     enzymatically inactive; this is analogous to what is found
                     with STEP46 and STEP20. STEP20 is a truncated version of
                     STEP46 produced through alternative splicing and a
                     retained intron contains a stop codon; novel nucleotide
                     sequences have been found in the mouse genomic clone"
                     /codon_start=1
                     /product="protein tyrosine phosphatase STEP38"
                     /protein_id="AAA73573.1"
                     /translation="MCCSERLLGLPQPVEMEAPDEAEGLPSKQKEMPPPPPPSPPSEP
                     AQKLPPQGAGSHSLTVRSSLCLFAASQFLLACGVLWLSGHGHSWLQNTTDLISSSLTV
                     LNHLGPVAWLGSGTWGIPSLLLVSLTVSLVIVTTLVWHLLKAPPEPPAPLPPEDRRQS
                     VSRQPSFTYSEWMEEKVEDDFLDLDAVPETPVFDCVMDIKPETDPASLTVKSMGLQER
                     RGSNVSLTLDMCTPGCNEEGFGYLVSPREESAHEYLLSASRVLRAEELHEKALDPFLL
                     QAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVRLTSPDPEDPLSSYINANY
                     IRVCSSIPRAFH"
ORIGIN      
        1 gactagtaaa gaggctactg cggaaattta agctacagag gagagcagtg gctggaacca
       61 ttctttttag tagccgcgtc ctgcttctca ttttcgccat gtaaaactgc tgcgtgtgcg
      121 atccactctg cccccacaga gcctgcagtg gggtgaaatg tcaggaacaa gccccggaga
      181 aggagtgaga gagagagcca ggctgctgat gactccgagg gaggaaccct ggacatgtgc
      241 tgtagtgaga ggctgttggg tctcccccag ccggtagaga tggaagcacc ggacgaggcc
      301 gaaggactcc ccagcaagca gaaagagatg ccaccacccc cgccaccctc accgccctct
      361 gagccagctc agaagctgcc acctcaaggc gctgggagcc actccctcac cgtcagaagc
      421 agcctgtgcc tgtttgctgc ctctcagttc ctgcttgcct gtggggtgct ctggctcagt
      481 ggccatggcc actcctggct gcagaacacc acagacctca tctcctcctc gctcacagtg
      541 ttgaaccatc tgggacctgt ggcctggctg ggttctggga cctgggggat accaagtctg
      601 ctgctagtct ctctgactgt gagcctggtc atcgtcacca ccctggtgtg gcacctcctc
      661 aaggcacccc cagagccacc tgccccactg cccccagagg acaggcgtca atcagtgagc
      721 cggcagcctt ccttcaccta ctcagagtgg atggaggaga aggtagagga tgacttcctg
      781 gacctggacg cggtgcccga gacacctgtg tttgactgtg tgatggacat caagcctgag
      841 actgatcctg cctcattgac tgtcaagtcc atgggtctac aggagaggag aggatccaat
      901 gtctccttga ccctggacat gtgtactcct ggctgcaatg aggagggctt cggctacctg
      961 gtgtctccac gagaagagtc agcccatgag tatctgctca gcgcctcccg tgtcctccgg
     1021 gcagaagagc tacatgaaaa ggctctggac cctttcttgc tgcaggcgga attctttgaa
     1081 atccccatga actttgtgga tccaaaagag tatgacatcc cagggctggt gcggaagaat
     1141 cggtacaaaa ccatccttcc caatcctcac agcagggtac gtctgacgtc accagaccct
     1201 gaagatcctc tgagttccta catcaatgcc aactacatcc gggtatgtag ctccatccca
     1261 agagccttcc actaaaggag aggcctgagc tgatgcaatc tgtccttcag acttgtcccc
     1321 caagccagtg tggctcctac aagccccaag aggagcctaa gtgtgggatg gggccctggg
     1381 agtgccacct ccacccctga cctgacgggc tggacttggg tggctgcagg gctacagtgg
     1441 ggaggagaag gtgtacatcg ccacgcaggg acccatcgtc agcactgtgg ccgacttttg
     1501 gcgcatggtg tggcaggagc gcacacccat catcgtcatg atcaccaaca tcgaggagat
     1561 gaacgaggta gggaccctgt gccattgctc gttgcgccct gctctgtgcc cccacatgaa
     1621 gcatcccctt tgcataataa tcttcctgag gatctcgtga gcctggcgtg cactcaactg
     1681 tcaacataag gaaatgagag gtgttgacag ttaaggtata cactcaacgc cacacaaagc
     1741 ctagcagagc ctggagctgg cttctcccac cccatccaat ggctgtattt gagtcatgat
     1801 ctgctgcctc ccagtctgcc gctgatacgc atgttcatga tgagcaagct catttaattg
     1861 aatctccatt gttt
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.