Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: U28216.1
FASTA Graphics
LOCUS MMU28216 1874 bp mRNA linear ROD 13-DEC-2001 DEFINITION Mus musculus protein tyrosine phosphatase STEP38 mRNA, complete cds. ACCESSION U28216 VERSION U28216.1 KEYWORDS . SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1874) AUTHORS Bult,A., Zhao,F., Dirkx,R. Jr., Raghunathan,A., Solimena,M. and Lombroso,P.J. TITLE STEP: a family of brain-enriched PTPs. Alternative splicing produces transmembrane, cytosolic and truncated isoforms JOURNAL Eur. J. Cell Biol. 72 (4), 337-344 (1997) PUBMED 9127733 REFERENCE 2 (bases 1 to 1874) AUTHORS Lombroso,P.J. TITLE Direct Submission JOURNAL Submitted (01-JUN-1995) Paul J. Lombroso, Child Study Center, Yale University School of Medicine, 230 South Frontage Road, New Haven, CT 06520, USA FEATURES Location/Qualifiers source 1..1874 /organism="Mus musculus" /mol_type="mRNA" /strain="BALB/c" /db_xref="taxon:10090" /clone_lib="brain cDNA lambda gt11 library from Clontech (ML1042b)" /dev_stage="adult" CDS 235..1275 /note="alternative spliced member of the STEP family of PTPs; STEP38 is a truncated form of STEP61; a new stop codon is introduced through a retained intron; the new stop codon is upstream of the conserved phosphatase domain, thus STEP38 lacks a phosphatase domain and is enzymatically inactive; this is analogous to what is found with STEP46 and STEP20. STEP20 is a truncated version of STEP46 produced through alternative splicing and a retained intron contains a stop codon; novel nucleotide sequences have been found in the mouse genomic clone" /codon_start=1 /product="protein tyrosine phosphatase STEP38" /protein_id="AAA73573.1" /translation="MCCSERLLGLPQPVEMEAPDEAEGLPSKQKEMPPPPPPSPPSEP AQKLPPQGAGSHSLTVRSSLCLFAASQFLLACGVLWLSGHGHSWLQNTTDLISSSLTV LNHLGPVAWLGSGTWGIPSLLLVSLTVSLVIVTTLVWHLLKAPPEPPAPLPPEDRRQS VSRQPSFTYSEWMEEKVEDDFLDLDAVPETPVFDCVMDIKPETDPASLTVKSMGLQER RGSNVSLTLDMCTPGCNEEGFGYLVSPREESAHEYLLSASRVLRAEELHEKALDPFLL QAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVRLTSPDPEDPLSSYINANY IRVCSSIPRAFH" ORIGIN 1 gactagtaaa gaggctactg cggaaattta agctacagag gagagcagtg gctggaacca 61 ttctttttag tagccgcgtc ctgcttctca ttttcgccat gtaaaactgc tgcgtgtgcg 121 atccactctg cccccacaga gcctgcagtg gggtgaaatg tcaggaacaa gccccggaga 181 aggagtgaga gagagagcca ggctgctgat gactccgagg gaggaaccct ggacatgtgc 241 tgtagtgaga ggctgttggg tctcccccag ccggtagaga tggaagcacc ggacgaggcc 301 gaaggactcc ccagcaagca gaaagagatg ccaccacccc cgccaccctc accgccctct 361 gagccagctc agaagctgcc acctcaaggc gctgggagcc actccctcac cgtcagaagc 421 agcctgtgcc tgtttgctgc ctctcagttc ctgcttgcct gtggggtgct ctggctcagt 481 ggccatggcc actcctggct gcagaacacc acagacctca tctcctcctc gctcacagtg 541 ttgaaccatc tgggacctgt ggcctggctg ggttctggga cctgggggat accaagtctg 601 ctgctagtct ctctgactgt gagcctggtc atcgtcacca ccctggtgtg gcacctcctc 661 aaggcacccc cagagccacc tgccccactg cccccagagg acaggcgtca atcagtgagc 721 cggcagcctt ccttcaccta ctcagagtgg atggaggaga aggtagagga tgacttcctg 781 gacctggacg cggtgcccga gacacctgtg tttgactgtg tgatggacat caagcctgag 841 actgatcctg cctcattgac tgtcaagtcc atgggtctac aggagaggag aggatccaat 901 gtctccttga ccctggacat gtgtactcct ggctgcaatg aggagggctt cggctacctg 961 gtgtctccac gagaagagtc agcccatgag tatctgctca gcgcctcccg tgtcctccgg 1021 gcagaagagc tacatgaaaa ggctctggac cctttcttgc tgcaggcgga attctttgaa 1081 atccccatga actttgtgga tccaaaagag tatgacatcc cagggctggt gcggaagaat 1141 cggtacaaaa ccatccttcc caatcctcac agcagggtac gtctgacgtc accagaccct 1201 gaagatcctc tgagttccta catcaatgcc aactacatcc gggtatgtag ctccatccca 1261 agagccttcc actaaaggag aggcctgagc tgatgcaatc tgtccttcag acttgtcccc 1321 caagccagtg tggctcctac aagccccaag aggagcctaa gtgtgggatg gggccctggg 1381 agtgccacct ccacccctga cctgacgggc tggacttggg tggctgcagg gctacagtgg 1441 ggaggagaag gtgtacatcg ccacgcaggg acccatcgtc agcactgtgg ccgacttttg 1501 gcgcatggtg tggcaggagc gcacacccat catcgtcatg atcaccaaca tcgaggagat 1561 gaacgaggta gggaccctgt gccattgctc gttgcgccct gctctgtgcc cccacatgaa 1621 gcatcccctt tgcataataa tcttcctgag gatctcgtga gcctggcgtg cactcaactg 1681 tcaacataag gaaatgagag gtgttgacag ttaaggtata cactcaacgc cacacaaagc 1741 ctagcagagc ctggagctgg cttctcccac cccatccaat ggctgtattt gagtcatgat 1801 ctgctgcctc ccagtctgcc gctgatacgc atgttcatga tgagcaagct catttaattg 1861 aatctccatt gttt //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on