Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: LM644205.1
FASTA Graphics
LOCUS LM644205 723 bp mRNA linear ROD 28-NOV-2019 DEFINITION TPA_inf: Rattus norvegicus Ghd12 gene for growth hormone d12. ACCESSION LM644205 VERSION LM644205.1 KEYWORDS Third Party Data; TPA; TPA:inferential. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 AUTHORS Premzl,M. TITLE Third party data gene data set of eutherian growth hormone genes JOURNAL Genom Data 6, 166-169 (2015) PUBMED 26697363 REMARK Publication Status: Online-Only REFERENCE 2 AUTHORS Premzl,M. TITLE Curated eutherian third party data gene data sets JOURNAL Data Brief 6, 208-213 (2015) PUBMED 26862561 REMARK Publication Status: Online-Only REFERENCE 3 AUTHORS Premzl,M. TITLE Eutherian third-party data gene collections JOURNAL Gene Rep 16, 100414-100414 (2019) REMARK DOI: 10.1016/j.genrep.2019.100414 REFERENCE 4 (bases 1 to 723) AUTHORS Premzl,M. TITLE Direct Submission JOURNAL Submitted (21-JUN-2014) Premzl M., Laboratory of Genomics, Centre of Animal Reproduction, 55 Heinzel St. Zagreb, 10000, CROATIA COMMENT The eutherian third party data gene data sets FR734011-FR734074, HF564658-HF564785, HF564786-HF564815, HG328835-HG329089, HG426065-HG426183, HG931734-HG931849 and LM644135-LM644234 were deposited in European Nucleotide Archive under research project 'Comparative genomic analysis of eutherian genes'. The 812 complete coding sequences were curated using tests of reliability of eutherian public genomic sequences included in eutherian comparative genomic analysis protocol including gene annotations, phylogenetic analysis and protein molecular evolution analysis. Project leader: Marko Premzl PhD ; E-mail address: Marko.Premzl@alumni.anu.edu.au ; Internet: http://www.ncbi.nlm.nih.gov/myncbi/mpremzl/cv/130205/ PRIMARY TPA_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-28 TI103823261 236-263 29-207 TI924801889 84-262 208-246 TI934445283 399-437 247-354 TI1708027768 483-590 c 355-534 TI1664699226 257-436 c 535-723 TI133373195 239-427 c FEATURES Location/Qualifiers source 1..723 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" gene 1..723 /gene="Ghd12" CDS 1..723 /gene="Ghd12" /codon_start=1 /product="growth hormone d12" /protein_id="CDW51452.1" /db_xref="GOA:Q4QRA1" /db_xref="InterPro:IPR001400" /db_xref="InterPro:IPR009079" /db_xref="UniProtKB/TrEMBL:Q4QRA1" /translation="MLPLSQPRFSGALLMLVISNLLLWEKTASVPACHLEEGGCWDPL VNTFNSAIQRAEVIQNLAEQIHEEFYHNPFSSAQFVTLVARMYRHDQAVYRARYHCPS NSTNPPLHGPEHENIKTKKYLKMMINFVGSWISPLFHLVLELRGMQNVPEVILSKAKD IEENNREILEDLRWILTKVYPTAKMKEKIISWDYLSSIKSNEKSEKFLAIFNISHCLR VDIFYTKFHLRALMCRITGKEC" ORIGIN 1 atgctgccat tgagtcaacc tcgtttttca ggggcactct tgatgctggt gatatcaaac 61 ttgcttctgt gggagaaaac tgcatcagtt cctgcttgtc acctggaaga agggggttgc 121 tgggatcccc ttgtgaacac atttaacagt gccatccagc gagctgaagt catccagaat 181 cttgctgagc aaatacatga agagttttac cacaatccat tctcatctgc acaatttgta 241 acactggttg cacgcatgta taggcatgat caggctgttt acagagccag atatcactgc 301 ccttctaaca gcacaaaccc accacttcat ggacctgaac atgaaaacat caaaactaaa 361 aagtatttaa aaatgatgat caattttgtg ggttcctgga tcagcccttt attccatcta 421 gtgcttgaac tgagaggcat gcaaaatgtt cctgaagtca tcctctcaaa agctaaggat 481 atagaagaaa acaacagaga aattctggag gaccttaggt ggatactcac caaggtctat 541 cctacagcaa agatgaagga aaaaattatc agctgggact atctttcatc cataaaatca 601 aatgaaaaaa gtgaaaaatt tttggcaatt tttaacattt ctcactgcct acgtgttgat 661 atattctaca ctaaatttca tctgagagca ttgatgtgtc gcataacagg gaaagaatgc 721 taa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on