Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AX659339.1
FASTA Graphics
LOCUS AX659339 927 bp DNA linear PAT 22-MAR-2003 DEFINITION Sequence 171 from Patent WO03000735. ACCESSION AX659339 VERSION AX659339.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 AUTHORS Martinez,R.A. and Sigurdsson,G.T. TITLE Nucleic acids encoding olfactory receptors JOURNAL Patent: WO 03000735-A2 171 03-JAN-2003; Decode Genetics EHF. (IS) FEATURES Location/Qualifiers source 1..927 /organism="Homo sapiens" /mol_type="unassigned DNA" /db_xref="taxon:9606" CDS 1..>927 /note="unnamed protein product" /codon_start=1 /protein_id="CAD79930.1" /translation="MQQNNSVTEFILLGLTQDPLRQKIVFVIFLIFYMGTVVGNMLII VTIKSSRTLGSPMYFFLFYLSFADSCFSTSTAPRLIVDALSEKKIITYNECMTQVFAL HLFGCMEIFVLILMAVDRYVAICKPLRYPTIMSQQVCIILIVLAWIGSLIHSTAQIIL ALRLPFCGPYLIDHYCCDLQPLLKLACMDTYMINLLLVSNSGAICSSSFMILIISYIV ILHSLRNHSAKGKKKALSACTSHIIVVILFFGPCIFIYTRPPTTFPMDKMVAVFYTIG PPFLNPLIYTLRNAEVKNAMRKLWHGKIISENK" ORIGIN 1 atgcagcaaa ataacagtgt gactgaattc atactgttag gattaacaca ggatcccttg 61 aggcagaaaa tagtgtttgt aatcttctta attttctata tgggaactgt ggtggggaat 121 atgctcatta ttgtgaccat caagtccagc cggacactag gaagccccat gtacttcttt 181 ctattttatt tgtcctttgc agattcttgc ttttcaactt ccacagcccc tagattaatt 241 gtggatgctc tctctgaaaa gaaaattata acctacaatg agtgcatgac acaagtcttt 301 gcactacatt tatttggctg catggagatc tttgtcctca ttctcatggc tgttgatcgc 361 tatgtggcca tctgtaagcc cttgcgttac ccaaccatca tgagccagca ggtctgcatc 421 atcctgattg ttcttgcctg gatagggtct ttaatacact ctacagctca gattatcctg 481 gccttaagat tgcctttctg tggaccctat ttgattgatc attattgctg tgatttgcag 541 cccttgttga aacttgcctg catggacact tacatgatca acctgctgtt ggtgtctaac 601 agtggggcaa tttgctcaag tagtttcatg attttgataa tttcatatat tgtcatcttg 661 cattcactga gaaaccacag tgccaaaggg aagaaaaagg ctctctccgc ttgcacgtct 721 cacataattg tagtcatctt attctttggc ccatgtatat tcatatatac acgccccccg 781 accactttcc ccatggacaa gatggtggca gtattttata ctattggacc accctttctc 841 aatccactca tctacacact gaggaatgca gaagtgaaaa atgccatgag aaagttatgg 901 catggcaaaa ttatttcaga aaacaaa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on