Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AX880656.1
FASTA Graphics
LOCUS AX880656 1654 bp DNA linear PAT 17-DEC-2003 DEFINITION Sequence 15561 from Patent EP1074617. ACCESSION AX880656 VERSION AX880656.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 AUTHORS Ota,T., Isogai,T., Nishikawa,T., Hayashi,K., Saito,K., Yamamoto,J., Ishii,S., Sugiyama,T., Wakamatsu,A., Nagai,K. and Otsuki,T. TITLE Primers for synthesising full-length cDNA and their use JOURNAL Patent: EP 1074617-A2 15561 07-FEB-2001; Research Association for Biotechnology (JP) FEATURES Location/Qualifiers source 1..1654 /organism="Homo sapiens" /mol_type="unassigned DNA" /db_xref="taxon:9606" CDS 37..1020 /note="unnamed protein product" /codon_start=1 /protein_id="CAE91032.1" /translation="MFPSRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFF SLLWLQLSCSGDVARAVRGQGQETSGPPRACPPEPPPEHWEEDASWGPHRLAVLVPFR ERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIA MHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMS NRFWGWGREDDEFYRRIKGAGLQLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQ EQFKVDREGGLNTVKYHVASRTALSVGGAPCTVLNIMLDCDKTATPWCTFS" ORIGIN 1 gagcgcctgc cccatgcgcc gccgcctctc cgcacgatgt tcccctcgcg gaggaaagcg 61 gcgcagctgc cctgggagga cggcaggtcc gggttgctct ccggcggcct ccctcggaag 121 tgttccgtct tccacctgtt cgtggcctgc ctctcgctgg gcttcttctc cctactctgg 181 ctgcagctca gctgctctgg ggacgtggcc cgggcagtca ggggacaagg gcaggagacc 241 tcgggccctc cccgcgcctg ccccccagag ccgccccctg agcactggga agaagacgca 301 tcctggggcc cccaccgcct ggcagtgctg gtgcccttcc gcgaacgctt cgaggagctc 361 ctggtcttcg tgccccacat gcgccgcttc ctgagcagga agaagatccg gcaccacatc 421 tacgtgctca accaggtgga ccacttcagg ttcaaccggg cagcgctcat caacgtgggc 481 ttcctggaga gcagcaacag cacggactac attgccatgc acgacgttga cctgctccct 541 ctcaacgagg agctggacta tggctttcct gaggctgggc ccttccacgt ggcctccccg 601 gagctccacc ctctctacca ctacaagacc tatgtcggcg gcatcctgct gctctccaag 661 cagcactacc ggctgtgcaa tgggatgtcc aaccgcttct ggggctgggg ccgcgaggac 721 gacgagttct accggcgcat taagggagct gggctccagc ttttccgccc ctcgggaatc 781 acaactgggt acaagacatt tcgccacctg cacgacccag cctggcggaa gagggaccag 841 aagcgcatcg cagctcaaaa acaggagcag ttcaaggtgg acagggaggg aggcctgaac 901 actgtgaagt accatgtggc ttcccgcact gccctgtctg tgggcggggc cccctgcact 961 gtcctcaaca tcatgttgga ctgtgacaag accgccacac cctggtgcac attcagctga 1021 gctggatgga cagtgaggaa gcctgtacct acaggccata ttgctcaggc tcaggacaag 1081 gcctcaggtc gtgggcccag ctctgacagg atgtggagtg gccaggacca agacagcaag 1141 ctacgcaatt gcagccaccc ggccgccaag gcaggcttgg gctgggccag gacacgtggg 1201 gtgcctggga cgctgcttgc catgcacagt gatcagagag aggctggggt gtgtcctgtc 1261 cgggaccccc cctgccttcc tgctcaccct actctgacct ccttcacgtg cccaggcctg 1321 tgggtagtgg ggagggctga acaggacaac ctctcatcac ccccactctt gttccttcct 1381 gctgggctgc ctcgtgcaga gacacagtgt aggggccatg cagctggcgt aggtggcagt 1441 tgggcctggt gagggttagg acttcagaaa ccagagcaca agccccacag agggggaaca 1501 gccagcaccg ctctagctgg ttgttgccat gccggaatgt gggcctagtg ttgccagatc 1561 ttctgatttt tcgaaagaaa ctagaatgct ggattcttaa gtgatatctt ctgatttttt 1621 aaatgatagc acctaaatga aactttcaaa aagt //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on