Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: M29470.1
FASTA Graphics
LOCUS HUMIGHCV 489 bp mRNA linear PRI 26-JUL-2016 DEFINITION Human Ig rearranged anti-myelin H-chain mRNA V-J4-region, hybridoma AE6-5, 5' end. ACCESSION M29470 VERSION M29470.1 KEYWORDS J-region; V-region; autoantibody; immunoglobulin heavy chain; processed gene; variable region subgroup VH-III. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 489) AUTHORS Spatz,L.A., Wong,K.K., Williams,M., Desai,R., Golier,J., Berman,J.E., Alt,F.W. and Latov,N. TITLE Cloning and sequence analysis of the VH and VL regions of an anti-myelin/DNA antibody from a patient with peripheral neuropathy and chronic lymphocytic leukemia JOURNAL J. Immunol. 144 (7), 2821-2828 (1990) PUBMED 2156935 COMMENT Draft entry and printed sequence kindly submitted by L.A.Spatz, 26-OCT-1989, for release after publication. Columbia University, Department of Neurology BB-322, 630 W. 168th street, New York, NY 10032. FEATURES Location/Qualifiers source 1..489 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="14q32.33" gene 1..489 /gene="IGH@" CDS 64..>489 /gene="IGH@" /note="V-J4-region precursor" /codon_start=1 /product="IgH" /protein_id="AAA52856.1" /db_xref="GDB:G00-118-731" /translation="MEFGLSWLFLVAILKGVQCEVQLLESGGGLVQPEGSLRLSCAVS GFTFSSFAMTWVRQAPGKGLEWVSAISTSGGSTYYAESVKGRFTISRDNSMHTLYLQM NSLRAEDTAVYYCAKGPTYCSRISCPPDYWGQGTLVTVSS" sig_peptide 64..120 /gene="IGH@" /note="Ig H-chain signal peptide" mat_peptide 121..>489 /gene="IGH@" /product="Ig H-chain" misc_recomb 450..451 /gene="IGH@" ORIGIN 1 cccagccctg ggattttcag gtgttttcat ttggtgatca ggactgaaca gagagaactc 61 accatggagt ttgggctgag ctggcttttt cttgtggcta ttttaaaagg tgtccagtgt 121 gaggtgcagc tgttggagtc tgggggaggc ttggtacagc ctgaggggtc cctgagactc 181 tcctgtgcag tctccggatt cacttttagc agctttgcca tgacctgggt ccgccaggct 241 ccagggaagg ggctggagtg ggtctcagct attagtacta gtggtggtag cacatactac 301 gcagagtccg tgaagggccg cttcaccatc tccagagaca attccatgca cacgctgtat 361 ctgcaaatga acagcctgag agccgaggac acggccgtct attactgtgc gaaaggtcct 421 acatattgta gtagaatcag ctgccctccg gactactggg gccagggaac cctggtcacc 481 gtctcctca //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on