Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_001002816.3
FASTA Graphics
LOCUS NM_001002816 554 bp mRNA linear ROD 01-APR-2024 DEFINITION Rattus norvegicus serine peptidase inhibitor, Kazal type 7 (Spink7), mRNA. ACCESSION NM_001002816 XM_579086 VERSION NM_001002816.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 554) AUTHORS Puente,X.S. and Lopez-Otin,C. TITLE A genomic analysis of rat proteases and protease inhibitors JOURNAL Genome Res 14 (4), 609-622 (2004) PUBMED 15060002 REFERENCE 2 (bases 1 to 554) AUTHORS Cui,Y., Wang,J., Zhang,X., Lang,R., Bi,M., Guo,L. and Lu,S.H. TITLE ECRG2, a novel candidate of tumor suppressor gene in the esophageal carcinoma, interacts directly with metallothionein 2A and links to apoptosis JOURNAL Biochem Biophys Res Commun 302 (4), 904-915 (2003) PUBMED 12646258 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAXUCZ010000018.1. On Oct 25, 2022 this sequence version replaced NM_001002816.2. Sequence Note:. ##RefSeq-Attributes-START## inferred exon combination :: based on alignments, homology RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-126 JAXUCZ010000018.1 58319942-58320067 c 127-152 JAXUCZ010000018.1 58319041-58319066 c 153-277 JAXUCZ010000018.1 58318009-58318133 c 278-554 JAXUCZ010000018.1 58316302-58316578 c FEATURES Location/Qualifiers source 1..554 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="18" /map="18q12.1" gene 1..554 /gene="Spink7" /gene_synonym="Ecg2; Ecrg2" /note="serine peptidase inhibitor, Kazal type 7" /db_xref="GeneID:408237" /db_xref="RGD:1303077" exon 1..126 /gene="Spink7" /gene_synonym="Ecg2; Ecrg2" /inference="alignment:Splign:2.1.0" CDS 63..323 /gene="Spink7" /gene_synonym="Ecg2; Ecrg2" /note="serine protease inhibitor Kazal-type 7; serine peptidase inhibitor, Kazal type 7 (putative); ECRG-2; esophagus cancer-related gene 2 protein; esophagus cancer-related protein 2" /codon_start=1 /product="serine protease inhibitor Kazal-type 7 precursor" /protein_id="NP_001002816.2" /db_xref="GeneID:408237" /db_xref="RGD:1303077" /translation="MKLLGGLLLLFTATCLCNSFSEVTSHPSPTVDCDIYKKYPVVAI PCPIENIPVCGSDYITYGNKCKLCTEILRSNGKIQFLHEGHC" sig_peptide 63..119 /gene="Spink7" /gene_synonym="Ecg2; Ecrg2" /inference="COORDINATES: ab initio prediction:SignalP:6.0" exon 127..152 /gene="Spink7" /gene_synonym="Ecg2; Ecrg2" /inference="alignment:Splign:2.1.0" exon 153..277 /gene="Spink7" /gene_synonym="Ecg2; Ecrg2" /inference="alignment:Splign:2.1.0" exon 278..554 /gene="Spink7" /gene_synonym="Ecg2; Ecrg2" /inference="alignment:Splign:2.1.0" ORIGIN 1 gggacattcg ccttcaagcc aatctgagat cacttagcct ccacaccata gccctctcca 61 ccatgaagct ccttggtggt ctcctgctgc tcttcacagc aacctgtttg tgcaacagct 121 tctccgaagt taccagccac ccttcaccca cagtggactg tgacatatac aagaagtacc 181 cagtagtggc catcccttgc cccattgaaa acatcccagt ttgtggatct gactatatca 241 cttacgggaa taaatgcaag ttgtgtacag agatcttgag aagtaatggg aaaattcagt 301 ttcttcatga agggcactgc taacttctcc atggacaaag aaagaacagt gaagccttca 361 tcatgtgcct cacacgtggg ctctgatcga ctgcccttct ttgctgatgt tctggtggcg 421 tcagatctag attcagtcac tgtcggtgac tgtggatagt ccttgtgctc attcctatca 481 actcctgtct cctgatatat tacctttttt ggcacctgaa ttaaaaaaaa atctctccaa 541 aaagtttact ttta //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on