Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: X98115.1
FASTA Graphics
LOCUS X98115 917 bp mRNA linear PRI 23-JUL-2016 DEFINITION H.sapiens mRNA for cardiac titin, clone ZisL. ACCESSION X98115 VERSION X98115.1 KEYWORDS titin; Z-disc integral muscle protein. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 AUTHORS Gautel,M., Goulding,D., Bullard,B., Weber,K. and Furst,D.O. TITLE The central Z-disk region of titin is assembled from a novel repeat in variable copy numbers JOURNAL J. Cell. Sci. 109 (PT 11), 2747-2754 (1996) PUBMED 8937992 REFERENCE 2 (bases 1 to 917) AUTHORS Gautel,M.S. TITLE Direct Submission JOURNAL Submitted (23-MAY-1996) M.S. Gautel, EMBL Heidelberg, Structural Biology Division, Postfach 102209, Heidelberg, 69012, FRG FEATURES Location/Qualifiers source 1..917 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_type="myocytes" /tissue_type="cardiac muscle" /clone_lib="ZisL" /dev_stage="adult" CDS <1..>917 /note="isoform" /codon_start=1 /product="titin Z-disc" /protein_id="CAA66796.1" /db_xref="GOA:Q8WZ42" /db_xref="HGNC:HGNC:12403" /db_xref="InterPro:IPR000719" /db_xref="InterPro:IPR002290" /db_xref="InterPro:IPR003598" /db_xref="InterPro:IPR003599" /db_xref="InterPro:IPR003961" /db_xref="InterPro:IPR004168" /db_xref="InterPro:IPR007110" /db_xref="InterPro:IPR008266" /db_xref="InterPro:IPR008957" /db_xref="InterPro:IPR011009" /db_xref="InterPro:IPR012337" /db_xref="InterPro:IPR013098" /db_xref="InterPro:IPR013783" /db_xref="InterPro:IPR015129" /db_xref="InterPro:IPR017442" /db_xref="InterPro:IPR022682" /db_xref="PDB:1BPV" /db_xref="PDB:1G1C" /db_xref="PDB:1NCT" /db_xref="PDB:1NCU" /db_xref="PDB:1TIT" /db_xref="PDB:1TIU" /db_xref="PDB:1TKI" /db_xref="PDB:1TNM" /db_xref="PDB:1TNN" /db_xref="PDB:1WAA" /db_xref="PDB:1YA5" /db_xref="PDB:2A38" /db_xref="PDB:2BK8" /db_xref="PDB:2F8V" /db_xref="PDB:2ILL" /db_xref="PDB:2J8H" /db_xref="PDB:2J8O" /db_xref="PDB:2NZI" /db_xref="PDB:2RQ8" /db_xref="PDB:2WP3" /db_xref="PDB:2WWK" /db_xref="PDB:2WWM" /db_xref="PDB:3B43" /db_xref="PDB:3KNB" /db_xref="UniProtKB/Swiss-Prot:Q8WZ42" /translation="AAEAVATGAKEVKQDADKSAAVATVVAAVDMARVREPVISAVEQ TAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVVVAADKAKEQELKSRTKEVITTKQEQM HVTHEQIRKETEKTFVPKVVISAAKAKEQETRISEEITKKQKQVTQEAIRQETEITAA SMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEKIMKETRKTVVPKVIVATPKVKE QDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIAVATAKAKEQETILRTRETMA TRQEQIQVTHGKVDVGKKAEAVATVVAAV" repeat_region 28..183 /note="repeat 1" repeat_region 184..321 /note="repeat 2" repeat_region 322..450 /note="repeat 3" repeat_region 451..588 /note="repeat a2" repeat_region 589..726 /note="repeat a1" repeat_region 727..861 /note="repeat 4" repeat_region 862..>917 /note="repeat 5" ORIGIN 1 gcagcagagg ctgttgccac tggtgctaaa gaggtgaaac aagatgctga caaaagtgca 61 gctgttgcga ctgttgttgc tgccgttgat atggccagag tgagagaacc agtgatcagc 121 gctgtagagc agactgctca gaggacaacc acgactgctg tgcacatcca acctgctcaa 181 gaacaggtaa gaaaggaagc ggagaagact gctgtaacta aggtagtagt ggccgccgat 241 aaagccaagg aacaagaatt aaaatcaaga accaaagaag taattaccac aaagcaagag 301 cagatgcacg taactcatga gcagataaga aaagaaactg aaaaaacatt tgtaccaaag 361 gtagtaattt ccgcagctaa agccaaagaa caagaaacta gaatttctga agaaattact 421 aagaaacaga aacaagtaac tcaagaagca ataagacagg aaactgagat aactgctgca 481 tccatggtgg tagttgccac tgcaaagtcc acaaaactag aaacagtccc gggagctcaa 541 gaagaaacta ccacacaaca agatcaaatg cacctaagtt atgaaaagat aatgaaggaa 601 actaggaaaa cagttgtacc taaagtcata gttgccacac ccaaagtcaa agaacaagat 661 ttagtatcaa gaggtagaga aggcattact accaaaagag aacaagtgca aataactcag 721 gagaagatga gaaaggaagc cgagaaaact gccttgtcta caatagcagt tgctactgct 781 aaagccaaag aacaagaaac aatactgaga actagagaaa ctatggctac tagacaagaa 841 caaatccaag ttacccatgg aaaggtggac gttggaaaaa aggctgaagc tgtagcaaca 901 gttgttgctg cagtaga //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on