Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AB098743.2
FASTA Graphics
LOCUS AB098743 752 bp mRNA linear ROD 09-NOV-2006 DEFINITION Mus musculus Ypel4 mRNA for yippee-like 4, complete cds. ACCESSION AB098743 VERSION AB098743.2 KEYWORDS . SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 AUTHORS Hosono,K., Sasaki,T., Minoshima,S. and Shimizu,N. TITLE Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species JOURNAL Gene 340 (1), 31-43 (2004) PUBMED 15556292 REFERENCE 2 (bases 1 to 752) AUTHORS Shimizu,N., Minoshima,S., Sasaki,T. and Hosono,K. TITLE Direct Submission JOURNAL Submitted (25-DEC-2002) Nobuyoshi Shimizu, Keio University School of Medicine, Molecular Biology; 35 Shinanomachi, Shinjuku-ku, Tokyo 160-8582, Japan (E-mail:nshimizu@dmb.med.keio.ac.jp, Tel:81-3-3351-2370, Fax:81-3-3351-2370) COMMENT On Sep 29, 2004 this sequence version replaced AB098743.1. FEATURES Location/Qualifiers source 1..752 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="2" gene 1..752 /gene="Ypel4" CDS 277..660 /gene="Ypel4" /codon_start=1 /product="yippee-like 4" /protein_id="BAD51384.1" /translation="MPSCDPGPAPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDEL ISKSFQGSHGRAYLFNSVVNVGCGPAEQRLLLTGLHSVADIFCESCKTTLGWKYEQAF ETSQKYKEGKYIIEMSHMVKDNGWD" ORIGIN 1 cttcccaatt gaaggaacca acagagaaga gagaagagtg aacagagaga ttgaaagaga 61 tagacggaga tctctggagc agacctcaag gtgacttccc atttctatct ggttctcgtc 121 tggggggggc cctggcaggg cagccccccc acactgctac tgtcctgaaa cacggctcta 181 gccaatctgc tccgttgctt tacctgcgac cgtctctgtg ggggctgcac cgcaccagcc 241 cctccagccc gccagggcat cgtcctccaa cccgtcatgc ccagctgtga ccctggcccg 301 gcccccgcat gtttacccac caagactttc cgcagttacc tgccccgctg ccaccgcact 361 tacagttgcg tccactgtcg agcacacttg gccaaacacg atgagcttat ttccaagtcc 421 ttccaaggaa gccatggccg ggcctacctg tttaactccg tggtcaacgt gggttgtggg 481 ccagctgaac agcgcctcct gctcacagga ctccactcgg tagctgacat tttctgcgaa 541 agctgcaaga ccacactggg ctggaaatat gaacaggctt ttgagaccag ccagaaatac 601 aaagaaggga agtacatcat tgagatgtca cacatggtga aagacaacgg ctgggattga 661 ggggctcagc agcctgtgac cctcctccgc atgccccacc ctcctcacac cagtctcctg 721 gccctgctga gcagtccaca ccagcatgag ta //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on