Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: FJ465144.1
FASTA Graphics
LOCUS FJ465144 801 bp mRNA linear ROD 01-DEC-2011 DEFINITION Mus musculus LCN6 isoform beta (Lcn6) mRNA, complete cds, alternatively spliced. ACCESSION FJ465144 VERSION FJ465144.1 KEYWORDS . SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 801) AUTHORS Shen,J., Liu,Q. and Zhang,Y. TITLE Cloning and Characterization of mouse epididymis-specific gene Lcn6 JOURNAL Unpublished REFERENCE 2 (bases 1 to 801) AUTHORS Shen,J., Liu,Q. and Zhang,Y. TITLE Direct Submission JOURNAL Submitted (16-NOV-2008) Shanghai Key Laboratory of Molecular Andrology, Institute of Biochemistry and Cell Biology, 320 Yueyang Road, Shanghai 200031, China FEATURES Location/Qualifiers source 1..801 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="2" /map="2A3" /tissue_type="epididymis" gene 1..801 /gene="Lcn6" CDS 8..745 /gene="Lcn6" /note="lipocalin; transports small lipid molecules; alternatively spliced" /codon_start=1 /product="LCN6 isoform beta" /protein_id="ACS36664.1" /translation="MKVILLTAALLALVSIPWLQAVWLGRLDPKQLLGPWYVLAVASR AKDFMVEKDMKNVEGVVVTLTPDNKLRVESSRHGPGGCHQSTVELLKQESRWVFENPS LGILDYRVLGTNFKDYAVVFTQLEFGDEVFNTVSLYSRTEMASHEAMQLFTKWSQGLG FLSQQQAQLQKDLSSTEACGWDPGNCYSPILTTGSLLLQSLVHTRSSSECHTLDIAPQ HPGILVEVGRHGLCTVAGGTGADWLLS" ORIGIN 1 tcggagaatg aaggtgatcc ttctgactgc tgctcttctt gctttggtct ctattccctg 61 gttgcaggca gtgtggctgg gaaggctgga ccctaagcag ctcctcggtc cctggtatgt 121 cctggctgtg gcctcccgtg caaaggactt catggtggag aaggacatga agaatgtgga 181 aggtgtcgtg gtgactctta ctccagataa caaattgaga gttgagtcct ctcggcatgg 241 gccaggcgga tgtcatcaga gcaccgtgga gctgctgaag caagagtccc gatgggtgtt 301 tgagaatccc tctctgggta tattggatta tcgggtactg ggcactaact tcaaagacta 361 cgctgtcgtc ttcacacagc tggaatttgg ggatgaggtc ttcaacacag tgtcgttgta 421 cagtcggaca gagatggcta gccacgaagc catgcagcta ttcaccaaat ggagccaggg 481 gctgggcttc ttgtctcaac agcaggctca actgcagaag gacctttctt caacagaggc 541 ttgtgggtgg gatcctggga actgctacag ccccattctc acaactggct cgcttcttct 601 acagtcactt gtgcacacaa gatcctccag tgagtgccac accctggata tagcaccaca 661 gcatcctggc atcctggtgg aggtgggcag gcacggtctt tgcacagtgg ctggtggtac 721 tggcgctgat tggctgctct cctaggctct tgcttgggtt caaaataaaa tgatttcaca 781 agtaaaaaaa aaaaaaaaaa a //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on