Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: JZKL01000039.1
FASTA Graphics
LOCUS JZKL01000039 813 bp DNA linear BCT 26-JUL-2019 DEFINITION Enterobacter roggenkampii strain CIDEIMsCOL1 contig39, whole genome shotgun sequence. ACCESSION JZKL01000039 JZKL01000000 VERSION JZKL01000039.1 DBLINK BioProject: PRJNA271006 BioSample: SAMN03277188 KEYWORDS WGS. SOURCE Enterobacter roggenkampii ORGANISM Enterobacter roggenkampii Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex. REFERENCE 1 (bases 1 to 813) AUTHORS Adams,M., Sutton,G., Nelson,K., Bonomo,R., McCorrison,J., Sanka,R., Brinkac,L. and Nierman,W. TITLE Direct Submission JOURNAL Submitted (10-FEB-2015) JCVI, 4120 Capricorn Lane, La Jolla, CA 92037, USA COMMENT Annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (released 2013). Information about the Pipeline can be found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/ The organism was changed from 'Enterobacter cloacae' to 'Enterobacter cloacae complex' in July 2016. The organism was changed from 'Enterobacter cloacae complex' to 'Enterobacter cloacae complex sp. CIDEIMsCOL1' in July 2016. ##Genome-Assembly-Data-START## Assembly Method :: SPAdes v. 3.1.0 Expected Final Version :: Yes Genome Coverage :: 181.92x Sequencing Technology :: Illumina HiSeq 2000 ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Date :: 03/10/2015 13:40:46 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline Annotation Method :: Best-placed reference protein set; GeneMarkS+ Annotation Software revision :: 2.10 (rev. 461190) Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes :: 4,737 CDS :: 4,615 Pseudo Genes :: 45 CRISPR Arrays :: 1 rRNAs :: 6 (5S, 16S, 23S) tRNAs :: 67 ncRNA :: 4 Frameshifted Genes :: 8 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..813 /organism="Enterobacter roggenkampii" /mol_type="genomic DNA" /submitter_seqid="contig39" /strain="CIDEIMsCOL1" /isolation_source="Bodily fluid" /host="Homo sapiens" /db_xref="taxon:1812935" /geo_loc_name="Colombia" /collection_date="2009" /collected_by="CIDEIM" /note="genotype: carbapenem resistant" gene complement(<1..>813) /locus_tag="RZ87_17620" CDS complement(<1..>813) /locus_tag="RZ87_17620" /inference="EXISTENCE: similar to AA sequence:RefSeq:WP_003089110.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="transposase" /protein_id="KJW96790.1" /translation="YVFCTLDALRTALRRHDVFVSPSWRYADPRLGLLDGAEWLAARP IICRSLGLTIDAKTTLDALSVELDATWLAVAARLPDNPAIQLSENTEGKTELSLGALD KLDEPCSLLQLRAAVSDLMPRVDLPEILLEIAARTGFSEAFTHVSERNARADNLVTSL CAVLLGGACNTGLEPLIRTDNPALRRDRLSWVSQNYIRDDTLSAANAILVGAQSQLEL AQVWGGGEVASADGMRFVVPVRTVHAGPNPKYFGTGRGVTWYNLISDQFSGLN" ORIGIN 1 gttgaggccg gagaattggt cggaaatcag gttgtaccag gtgacacccc ggccggtgcc 61 gaaatacttc ggattggggc cggcatgcac ggtgcgcacc ggtacgacga agcgcatgcc 121 atcggcggag gcgacctcgc cgccacccca gacttgggcc agttccagtt ggctttgcgc 181 tccgaccagg atggcgttag ccgctgacag ggtgtcgtcg cggatataat tctggctgac 241 ccaggacagc cggtcacggc gcagcgccgg gttgtcggtg cggatcaagg gctccaggcc 301 ggtgttgcag gccccgccca acagcaccgc gcagaggctg gtgaccaggt tgtcggcgcg 361 tgcattgcgt tcggagacat gggtgaaggc ctcggaaaag ccagtgcggg cggcgatttc 421 caagaggatt tccggcagat cgacacgcgg catcaggtca gacacggccg cccgcagttg 481 cagcaacgag cagggctcgt ccagcttgtc cagcgccccg agcgacagtt cggtcttgcc 541 ctcggtgttc tcgctcagtt gaatcgccgg gttgtcgggc aggcgcgcgg ctactgccag 601 ccaggttgca tccagctcga cggacaaggc gtccagggtg gttttggcgt cgatggtcag 661 gcccagtgac cggcagatga tcggtcgcgc cgccagccat tcggcaccgt cgagcaggcc 721 aagacgcggg tcggcatagc gccaactggg cgagacgaag acatcgtggc ggcgcagggc 781 cgtgcgcagc gcatcgagcg tgcagaacac ata //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on