Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: KR084637.1
FASTA Graphics
LOCUS KR084637 658 bp DNA linear INV 04-AUG-2015 DEFINITION Pseudamussium peslutrae voucher MT04962 cytochrome oxidase subunit 1 (COI) gene, partial cds; mitochondrial. ACCESSION KR084637 VERSION KR084637.1 KEYWORDS BARCODE. SOURCE mitochondrion Pseudamussium peslutrae ORGANISM Pseudamussium peslutrae Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia; Autobranchia; Pteriomorphia; Pectinida; Pectinoidea; Pectinidae; Pseudamussium. REFERENCE 1 (bases 1 to 658) AUTHORS Barco,A., Raupach,M.J., Laakmann,S., Neumann,H. and Knebelsberger,T. TITLE Identification of North Sea molluscs with DNA barcoding JOURNAL Mol Ecol Resour (2015) In press PUBMED 26095230 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 658) AUTHORS Barco,A., Raupach,M.J., Laakmann,S., Neumann,H. and Knebelsberger,T. TITLE Direct Submission JOURNAL Submitted (11-APR-2015) Marine Ecology, GEOMAR, Duesternbrooker Weg 20, Kiel, Schleswig Holstein 24105, Germany FEATURES Location/Qualifiers source 1..658 /organism="Pseudamussium peslutrae" /organelle="mitochondrion" /mol_type="genomic DNA" /specimen_voucher="MT04962" /db_xref="BOLD:BNAGB011-14.COI-5P" /db_xref="taxon:509987" /geo_loc_name="North Sea" /lat_lon="58.744 N 2.564 E" /collection_date="04-Aug-2011" /collected_by="Thomas Knebelsberger" /identified_by="Thomas Knebelsberger" /PCR_primers="fwd_seq: acaaatcayaargayatygg, rev_seq: tgrttyttyggncaycctgaa" gene <1..>658 /gene="COI" CDS <1..>658 /gene="COI" /codon_start=2 /transl_table=5 /product="cytochrome oxidase subunit 1" /protein_id="AKT25490.1" /translation="TMYIIIGMWSGMGGFSLSWMIRLELSRPGMWLPSVELYNSVVTL HALMMIFFFVMPVLIGGFGNWLLPILLGAIDMSFPRLNAFSFWLVPPALYMVVSSSFM NELSGTGWTMYPPLSSTPYHNGISTDMVILGLHLAGVSSSAASINYLVTFMNVRGLAY KAEFAPPFAWALSVTSLLLLISIPVLAGGLTMLILDRHFNCSFFDPAGGGDPILFQHL F" ORIGIN 1 cactatatat attattattg ggatgtggtc aggtatagga gggttttcgc tgagatggat 61 aattcgttta gaattaagcc gtcccggaat gtggcttccg agggtagagc tatataacag 121 ggtggtgacg ctacatgcgc tcataatgat ttttttcttt gtgatgcccg tgttaattgg 181 tgggttcggt aactggctac taccgattct tttgggggct attgatatga gttttcctcg 241 gttgaatgct tttaggtttt ggttagtgcc gcctgcttta tacatggtgg tgtcttcttc 301 tttcatgaat gagttgaggg gaactggctg gactatgtac ccccctctat ctagcactcc 361 ctaccataac gggattagaa cagatatggt tatcttaggg ctgcatttgg ctggggtaag 421 ttcttctgcc gcttctatta attacttagt tactttcata aatgttcggg gtcttgctta 481 caaggcggag tttgcccccc cttttgcgtg ggctctgtct gttactaggc tcttgttgtt 541 aatttctatc cctgtgttgg cggggggtct aacaatgttg attttagatc gacattttaa 601 ttgcaggttt tttgatcctg cggggggggg ggatccaatc cttttccagc acctattt //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on