Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: M16253.1
FASTA Graphics
LOCUS BOVGHWT 579 bp mRNA linear MAM 19-APR-1994 DEFINITION Bovine alternative growth hormone mRNA, exon 4, and the boundaries of the normally excised intron D. ACCESSION M16253 VERSION M16253.1 KEYWORDS alternative splicing; growth hormone. SOURCE Bos taurus (domestic cattle) ORGANISM Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos. REFERENCE 1 (bases 1 to 579) AUTHORS Hampson,R.K. and Rottman,F.M. TITLE Alternative processing of bovine growth hormone mRNA: nonsplicing of the final intron predicts a high molecular weight variant of bovine growth hormone JOURNAL Proc. Natl. Acad. Sci. U.S.A. 84 (9), 2673-2677 (1987) PUBMED 3472230 COMMENT Original source text: Bovine pituitary, cDNA to mRNA. For the sake of clarity, the intron for the wild type growth hormone is indicated in the FEATURES table, even though this sequence is an mRNA of a growth hormone which contains intron D as part of its coding region. FEATURES Location/Qualifiers source 1..579 /organism="Bos taurus" /mol_type="mRNA" /db_xref="taxon:9913" prim_transcript <1..579 /note="GH mRNA and intron" CDS join(<1..3,278..478) /note="growth hormone (wt)" /codon_start=1 /protein_id="AAA30547.1" /translation="PELQDGTPRAGQILKQTYDKFDTNMRSDDALLKNYALLSCFRND LHKTETYLRVMKCRRFGEASCAF" CDS <1..330 /note="growth hormone (alt.)" /codon_start=1 /protein_id="AAA30546.1" /translation="PVGMALWVPSMLGAMPALSWLSQENARGLGETDPCSLPLSSSPA LTQGKPFPLWKPPSSPFSKPVGEGGKWSGQEAAAPEGPSASLSLPPLAGAARWHPPGW ADPQADL" exon <1..3 /note="growth hormone (wt)" /number=4 exon <1..3 /note="growth hormone (wt), exon 4 (AA at 1); putative" intron 4..277 /note="GH intron" exon 278..>478 /note="growth hormone (wt)" /number=5 ORIGIN Unreported. 1 ccggtgggga tggcgttgtg ggtcccttcc atgctggggg ccatgcccgc cctctcctgg 61 cttagccagg agaatgcacg tgggcttggg gagacagatc cctgctctct ccctctttct 121 agcagtccag ccttgaccca ggggaaacct tttccccttt ggaaacctcc ttcctcgccc 181 ttctccaagc ctgtagggga gggtggaaaa tggagcgggc aggaggcagc tgctcctgag 241 ggcccttcgg cctctctgtc tctccctccc ttggcaggag ctgcaagatg gcaccccccg 301 ggctgggcag atcctcaagc agacctatga caaatttgac acaaacatgc gcagtgacga 361 cgcgctgctc aagaactacg ctctgctctc ctgcttccgg aacgacctgc ataagacgga 421 gacgtacctg agggtcatga agtgccgccg cttcggggag gccagctgtg ccttctagtt 481 gccagccatc tgttgtttgc ccctcccccg tgccttcctt gaccctggaa ggtgccactc 541 ccactgtcct ttcctaataa aatgaggaaa ttgcatcgc //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on