U.S. flag

An official website of the United States government

Homo sapiens receptor transporter protein 2 (RTP2), mRNA

NCBI Reference Sequence: NM_001004312.2

FASTA Graphics 

LOCUS       NM_001004312            1346 bp    mRNA    linear   PRI 30-JUL-2024
DEFINITION  Homo sapiens receptor transporter protein 2 (RTP2), mRNA.
ACCESSION   NM_001004312 XM_293633
VERSION     NM_001004312.2
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1346)
  AUTHORS   Luck,K., Kim,D.K., Lambourne,L., Spirohn,K., Begg,B.E., Bian,W.,
            Brignall,R., Cafarelli,T., Campos-Laborie,F.J., Charloteaux,B.,
            Choi,D., Cote,A.G., Daley,M., Deimling,S., Desbuleux,A., Dricot,A.,
            Gebbia,M., Hardy,M.F., Kishore,N., Knapp,J.J., Kovacs,I.A.,
            Lemmens,I., Mee,M.W., Mellor,J.C., Pollis,C., Pons,C.,
            Richardson,A.D., Schlabach,S., Teeking,B., Yadav,A., Babor,M.,
            Balcha,D., Basha,O., Bowman-Colin,C., Chin,S.F., Choi,S.G.,
            Colabella,C., Coppin,G., D'Amata,C., De Ridder,D., De Rouck,S.,
            Duran-Frigola,M., Ennajdaoui,H., Goebels,F., Goehring,L., Gopal,A.,
            Haddad,G., Hatchi,E., Helmy,M., Jacob,Y., Kassa,Y., Landini,S.,
            Li,R., van Lieshout,N., MacWilliams,A., Markey,D., Paulson,J.N.,
            Rangarajan,S., Rasla,J., Rayhan,A., Rolland,T., San-Miguel,A.,
            Shen,Y., Sheykhkarimli,D., Sheynkman,G.M., Simonovsky,E., Tasan,M.,
            Tejeda,A., Tropepe,V., Twizere,J.C., Wang,Y., Weatheritt,R.J.,
            Weile,J., Xia,Y., Yang,X., Yeger-Lotem,E., Zhong,Q., Aloy,P.,
            Bader,G.D., De Las Rivas,J., Gaudet,S., Hao,T., Rak,J.,
            Tavernier,J., Hill,D.E., Vidal,M., Roth,F.P. and Calderwood,M.A.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   2  (bases 1 to 1346)
  AUTHORS   Yu,T., Su,X., Pan,Y. and Zhuang,H.
  TITLE     Receptor-transporting protein (RTP) family members play divergent
            roles in the functional expression of odorant receptors
  JOURNAL   PLoS One 12 (6), e0179067 (2017)
   PUBMED   28586385
  REMARK    GeneRIF: further cell-surface and permeabilized immunocytochemical
            studies revealed that odorant receptors (ORs) and the co-expressed
            RTP1S proteins were retained in the Golgi when co-transfected with
            RTP2, indicating that RTP1S and RTP2 could play different roles in
            the OR trafficking process.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1346)
  AUTHORS   Hancock,D.B., Soler Artigas,M., Gharib,S.A., Henry,A.,
            Manichaikul,A., Ramasamy,A., Loth,D.W., Imboden,M., Koch,B.,
            McArdle,W.L., Smith,A.V., Smolonska,J., Sood,A., Tang,W.,
            Wilk,J.B., Zhai,G., Zhao,J.H., Aschard,H., Burkart,K.M.,
            Curjuric,I., Eijgelsheim,M., Elliott,P., Gu,X., Harris,T.B.,
            Janson,C., Homuth,G., Hysi,P.G., Liu,J.Z., Loehr,L.R., Lohman,K.,
            Loos,R.J., Manning,A.K., Marciante,K.D., Obeidat,M., Postma,D.S.,
            Aldrich,M.C., Brusselle,G.G., Chen,T.H., Eiriksdottir,G.,
            Franceschini,N., Heinrich,J., Rotter,J.I., Wijmenga,C.,
            Williams,O.D., Bentley,A.R., Hofman,A., Laurie,C.C., Lumley,T.,
            Morrison,A.C., Joubert,B.R., Rivadeneira,F., Couper,D.J.,
            Kritchevsky,S.B., Liu,Y., Wjst,M., Wain,L.V., Vonk,J.M.,
            Uitterlinden,A.G., Rochat,T., Rich,S.S., Psaty,B.M., O'Connor,G.T.,
            North,K.E., Mirel,D.B., Meibohm,B., Launer,L.J., Khaw,K.T.,
            Hartikainen,A.L., Hammond,C.J., Glaser,S., Marchini,J., Kraft,P.,
            Wareham,N.J., Volzke,H., Stricker,B.H., Spector,T.D.,
            Probst-Hensch,N.M., Jarvis,D., Jarvelin,M.R., Heckbert,S.R.,
            Gudnason,V., Boezen,H.M., Barr,R.G., Cassano,P.A., Strachan,D.P.,
            Fornage,M., Hall,I.P., Dupuis,J., Tobin,M.D. and London,S.J.
  TITLE     Genome-wide joint meta-analysis of SNP and SNP-by-smoking
            interaction identifies novel loci for pulmonary function
  JOURNAL   PLoS Genet 8 (12), e1003098 (2012)
   PUBMED   23284291
REFERENCE   4  (bases 1 to 1346)
  AUTHORS   Behrens,M., Bartelt,J., Reichling,C., Winnig,M., Kuhn,C. and
            Meyerhof,W.
  TITLE     Members of RTP and REEP gene families influence functional bitter
            taste receptor expression
  JOURNAL   J Biol Chem 281 (29), 20650-20659 (2006)
   PUBMED   16720576
REFERENCE   5  (bases 1 to 1346)
  AUTHORS   Clark,A.J., Metherell,L.A., Cheetham,M.E. and Huebner,A.
  TITLE     Inherited ACTH insensitivity illuminates the mechanisms of ACTH
            action
  JOURNAL   Trends Endocrinol Metab 16 (10), 451-457 (2005)
   PUBMED   16271481
  REMARK    Review article
REFERENCE   6  (bases 1 to 1346)
  AUTHORS   Saito,H., Kubota,M., Roberts,R.W., Chi,Q. and Matsunami,H.
  TITLE     RTP family members induce functional expression of mammalian
            odorant receptors
  JOURNAL   Cell 119 (5), 679-691 (2004)
   PUBMED   15550249
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC068081.1, AY562236.1 and AC072022.19.
            
            On Sep 15, 2009 this sequence version replaced NM_001004312.1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC068081.1, BQ671345.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1968968, SAMEA2146411
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000358241.1/ ENSP00000350976.1
            RefSeq Select criteria :: based on manual assertion, conservation,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-673               BC068081.1         1-673
            674-1107            AY562236.1         245-678
            1108-1139           BC068081.1         1108-1139
            1140-1346           AC072022.19        84560-84766
FEATURES             Location/Qualifiers
     source          1..1346
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3q27.3"
     gene            1..1346
                     /gene="RTP2"
                     /gene_synonym="Z3CXXC2"
                     /note="receptor transporter protein 2"
                     /db_xref="GeneID:344892"
                     /db_xref="HGNC:HGNC:32486"
                     /db_xref="MIM:609138"
     exon            1..593
                     /gene="RTP2"
                     /gene_synonym="Z3CXXC2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    397..399
                     /gene="RTP2"
                     /gene_synonym="Z3CXXC2"
                     /note="upstream in-frame stop codon"
     CDS             430..1107
                     /gene="RTP2"
                     /gene_synonym="Z3CXXC2"
                     /note="zinc finger, 3CxxC-type 2; 3CxxC-type zinc finger
                     protein 2; receptor (chemosensory) transporter protein 2"
                     /codon_start=1
                     /product="receptor-transporting protein 2"
                     /protein_id="NP_001004312.2"
                     /db_xref="CCDS:CCDS33911.1"
                     /db_xref="GeneID:344892"
                     /db_xref="HGNC:HGNC:32486"
                     /db_xref="MIM:609138"
                     /translation="MCTSLTTCEWKKVFYEKMEVAKPADSWELIIDPNLKPSELAPGW
                     KQYLEQHASGRFHCSWCWHTWQSAHVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTA
                     RLDESSMLEENIEGLVDNLITSLREQCYEEDGGQYRIHVASRPDSGPHRAEFCEACQE
                     GIVHWKPSEKLLEEEVTTYTSEASKPRAQAGSGYNFLSLRWCLFWASLCLLVVYLQFS
                     FLSPAFF"
     misc_feature    1018..1086
                     /gene="RTP2"
                     /gene_synonym="Z3CXXC2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5QGT7.1);
                     transmembrane region"
     exon            594..1346
                     /gene="RTP2"
                     /gene_synonym="Z3CXXC2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 ctagggtgtc gtacttacca tagcacatga tgtggagaat gctagaagag cagttgggtg
       61 aagcagggcc accaaatagt ccttgcctcc tggagacctc tggaaatcca gatgagtgtg
      121 gtctgaggtt gggcctccca ctgtgcttgc tcctctcagg cctacccagc gctgcctctg
      181 aagcctaact cagggccctg aaactccccc ttggggcttc ccttctcccc agccctcact
      241 cttggtgccc tgcctggcta ccatggtaac aggttccagg gtaacagagg agggagctgg
      301 gtcctgttta ctcccagtcc tgccgatgag gattctgacc gtagacactg aattgtcccg
      361 tacctatccg tgctctttct gtgttctcac cagggctgag ctcgaactgc cacctctgcc
      421 agcaggacca tgtgtaccag cttgaccact tgtgagtgga agaaagtctt ctatgagaag
      481 atggaggtgg caaagccagc ggacagctgg gagctcatca tagaccccaa cctcaagccc
      541 agtgagctgg cccctggctg gaagcagtac ctggagcagc acgcctcagg caggttccac
      601 tgctcctggt gctggcacac ctggcagtct gcccatgtgg tcatcctctt ccacatgttc
      661 ctggaccgcg cccagcgggc gggctcggtg cgcatgcgcg tcttcaagca gctgtgctat
      721 gagtgcggca cggcgcggct ggacgagtcc agcatgctgg aggagaacat cgagggcctg
      781 gtggacaacc tcatcaccag cctgcgcgag cagtgctacg aggaggatgg tggccagtac
      841 cgcatccacg tggccagccg cccggacagc gggccgcatc gtgcagagtt ctgtgaggcc
      901 tgccaggagg gcatcgttca ctggaagccc agcgagaagc tgctggagga ggaggtgacc
      961 acctacacct ctgaagcctc caagccgagg gcccaggcgg gatccggcta caacttcttg
     1021 tctcttcgct ggtgcctctt ctgggcctct ctctgcctgc tcgttgttta cctgcagttc
     1081 tccttcctca gtcctgcctt cttttagtgg agctggttaa gggtgggaga gggcacatgg
     1141 gcttgagagt ggggaggaca cagtctggac ttgatcctgc tacagattca acatatgact
     1201 ggacaatccg gtcacctctc tgggcctcag ttaatgcatc tgcggaatga gaggattgca
     1261 ttagaagata ggcaatgatt ctttcactgg atgtgacaat aattggggga aggggaaaag
     1321 ggtgtaataa aggttttaga gcttgc
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.