LOCUS NM_001039182 375 bp mRNA linear PRI 20-SEP-2024
DEFINITION Homo sapiens bolA family member 2B (BOLA2B), transcript variant 1,
mRNA.
ACCESSION NM_001039182
VERSION NM_001039182.4
KEYWORDS RefSeq; MANE Select.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 375)
AUTHORS Huttlin,E.L., Bruckner,R.J., Navarrete-Perea,J., Cannon,J.R.,
Baltier,K., Gebreab,F., Gygi,M.P., Thornock,A., Zarraga,G., Tam,S.,
Szpyt,J., Gassaway,B.M., Panov,A., Parzen,H., Fu,S., Golbazi,A.,
Maenpaa,E., Stricker,K., Guha Thakurta,S., Zhang,T., Rad,R.,
Pan,J., Nusinow,D.P., Paulo,J.A., Schweppe,D.K., Vaites,L.P.,
Harper,J.W. and Gygi,S.P.
TITLE Dual proteome-scale networks reveal cell-specific remodeling of the
human interactome
JOURNAL Cell 184 (11), 3022-3040 (2021)
PUBMED 33961781
REFERENCE 2 (bases 1 to 375)
AUTHORS Talib,E.A. and Outten,C.E.
TITLE Iron-sulfur cluster biogenesis, trafficking, and signaling: Roles
for CGFS glutaredoxins and BolA proteins
JOURNAL Biochim Biophys Acta Mol Cell Res 1868 (1), 118847 (2021)
PUBMED 32910989
REMARK Review article
REFERENCE 3 (bases 1 to 375)
AUTHORS Frey,A.G., Palenchar,D.J., Wildemann,J.D. and Philpott,C.C.
TITLE A Glutaredoxin.BolA Complex Serves as an Iron-Sulfur Cluster
Chaperone for the Cytosolic Cluster Assembly Machinery
JOURNAL J Biol Chem 291 (43), 22344-22356 (2016)
PUBMED 27519415
REFERENCE 4 (bases 1 to 375)
AUTHORS Banci,L., Camponeschi,F., Ciofi-Baffoni,S. and Muzzioli,R.
TITLE Elucidating the Molecular Function of Human BOLA2 in GRX3-Dependent
Anamorsin Maturation Pathway
JOURNAL J Am Chem Soc 137 (51), 16133-16143 (2015)
PUBMED 26613676
REFERENCE 5 (bases 1 to 375)
AUTHORS Willems,P., Wanschers,B.F., Esseling,J., Szklarczyk,R., Kudla,U.,
Duarte,I., Forkink,M., Nooteboom,M., Swarts,H., Gloerich,J.,
Nijtmans,L., Koopman,W. and Huynen,M.A.
TITLE BOLA1 is an aerobic protein that prevents mitochondrial morphology
changes induced by glutathione depletion
JOURNAL Antioxid Redox Signal 18 (2), 129-138 (2013)
PUBMED 22746225
REFERENCE 6 (bases 1 to 375)
AUTHORS Li,H., Mapolelo,D.T., Randeniya,S., Johnson,M.K. and Outten,C.E.
TITLE Human glutaredoxin 3 forms [2Fe-2S]-bridged complexes with human
BolA2
JOURNAL Biochemistry 51 (8), 1687-1696 (2012)
PUBMED 22309771
REFERENCE 7 (bases 1 to 375)
AUTHORS Vaquerizas,J.M., Kummerfeld,S.K., Teichmann,S.A. and Luscombe,N.M.
TITLE A census of human transcription factors: function, expression and
evolution
JOURNAL Nat Rev Genet 10 (4), 252-263 (2009)
PUBMED 19274049
REMARK Review article
REFERENCE 8 (bases 1 to 375)
AUTHORS Zhou,Y.B., Cao,J.B., Wan,B.B., Wang,X.R., Ding,G.H., Zhu,H.,
Yang,H.M., Wang,K.S., Zhang,X. and Han,Z.G.
TITLE hBolA, novel non-classical secreted proteins, belonging to
different BolA family with functional divergence
JOURNAL Mol Cell Biochem 317 (1-2), 61-68 (2008)
PUBMED 18548201
REFERENCE 9 (bases 1 to 375)
AUTHORS Kasai,T., Inoue,M., Koshiba,S., Yabuki,T., Aoki,M., Nunokawa,E.,
Seki,E., Matsuda,T., Matsuda,N., Tomo,Y., Shirouzu,M., Terada,T.,
Obayashi,N., Hamana,H., Shinya,N., Tatsuguchi,A., Yasuda,S.,
Yoshida,M., Hirota,H., Matsuo,Y., Tani,K., Suzuki,H., Arakawa,T.,
Carninci,P., Kawai,J., Hayashizaki,Y., Kigawa,T. and Yokoyama,S.
TITLE Solution structure of a BolA-like protein from Mus musculus
JOURNAL Protein Sci 13 (2), 545-548 (2004)
PUBMED 14718656
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC137532.1 and AC106782.5.
On May 17, 2019 this sequence version replaced NM_001039182.3.
Summary: This gene is located within a region of a segmental
duplication on chromosome 16 and is identical to BOLA2 (bolA family
member 2). The product of this gene belongs to a family of proteins
that are widely conserved and may be involved in iron maturation.
Alternative splicing results in multiple transcript variants.
[provided by RefSeq, Feb 2016].
Transcript Variant: This variant (1) represents the longer
transcript and encodes the longer isoform (1).
##Evidence-Data-START##
Transcript exon combination :: SRR1163655.446162.1,
SRR7410570.599686.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA1965299, SAMEA1966682
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
MANE Ensembl match :: ENST00000651894.2/ ENSP00000498355.1
RefSeq Select criteria :: based on conservation, expression,
longest protein
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-356 BC137532.1 328-683
357-375 AC106782.5 1974-1992 c
FEATURES Location/Qualifiers
source 1..375
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="16"
/map="16p11.2"
gene 1..375
/gene="BOLA2B"
/gene_synonym="BOLA2"
/note="bolA family member 2B"
/db_xref="GeneID:654483"
/db_xref="HGNC:HGNC:32479"
exon 1..134
/gene="BOLA2B"
/gene_synonym="BOLA2"
/inference="alignment:Splign:2.1.0"
CDS 72..332
/gene="BOLA2B"
/gene_synonym="BOLA2"
/note="isoform 1 is encoded by transcript variant 1;
bolA-like protein 2B; BolA-like protein 2 member B; bolA
homolog 2B"
/codon_start=1
/product="bolA-like protein 2 isoform 1"
/protein_id="NP_001034271.2"
/db_xref="CCDS:CCDS32430.2"
/db_xref="GeneID:654483"
/db_xref="HGNC:HGNC:32479"
/translation="MELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKF
EGKPLLQRHRLVNACLAEELPHIHAFEQKTLTPDQWARERQK"
misc_feature 72..74
/gene="BOLA2B"
/gene_synonym="BOLA2"
/note="N-acetylmethionine.
/evidence=ECO:0000269|PubMed:12665801; propagated from
UniProtKB/Swiss-Prot (Q9H3K6.1); acetylation site"
exon 135..232
/gene="BOLA2B"
/gene_synonym="BOLA2"
/inference="alignment:Splign:2.1.0"
exon 233..375
/gene="BOLA2B"
/gene_synonym="BOLA2"
/inference="alignment:Splign:2.1.0"
regulatory 354..359
/regulatory_class="polyA_signal_sequence"
/gene="BOLA2B"
/gene_synonym="BOLA2"
/note="hexamer: ATTAAA"
polyA_site 375
/gene="BOLA2B"
/gene_synonym="BOLA2"
/note="major polyA site"
ORIGIN
1 aaggtagcgt ggccggcgcc cgagctgggg ttgtgtccct gctgggctgc cgttccagct
61 ggactgccgc catggaactc agcgccgaat acctccgcga gaagctgcag cgggacctgg
121 aggcggagca tgtggaggtg gaggacacga ccctcaaccg ttgctcctgt agcttccgag
181 tcctggtggt gtcggccaag ttcgagggga aaccgctgct tcagagacac aggctggtga
241 acgcgtgcct agcagaagag ctcccgcaca tccatgcctt tgaacagaaa accctgaccc
301 cagaccagtg ggcacgtgag cgacagaaat gagggactgg gatctgcaca gccattaaat
361 tataaatctg gacca
//