U.S. flag

An official website of the United States government

Homo sapiens bolA family member 2B (BOLA2B), transcript variant 1, mRNA

NCBI Reference Sequence: NM_001039182.4

FASTA Graphics 

LOCUS       NM_001039182             375 bp    mRNA    linear   PRI 20-SEP-2024
DEFINITION  Homo sapiens bolA family member 2B (BOLA2B), transcript variant 1,
            mRNA.
ACCESSION   NM_001039182
VERSION     NM_001039182.4
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 375)
  AUTHORS   Huttlin,E.L., Bruckner,R.J., Navarrete-Perea,J., Cannon,J.R.,
            Baltier,K., Gebreab,F., Gygi,M.P., Thornock,A., Zarraga,G., Tam,S.,
            Szpyt,J., Gassaway,B.M., Panov,A., Parzen,H., Fu,S., Golbazi,A.,
            Maenpaa,E., Stricker,K., Guha Thakurta,S., Zhang,T., Rad,R.,
            Pan,J., Nusinow,D.P., Paulo,J.A., Schweppe,D.K., Vaites,L.P.,
            Harper,J.W. and Gygi,S.P.
  TITLE     Dual proteome-scale networks reveal cell-specific remodeling of the
            human interactome
  JOURNAL   Cell 184 (11), 3022-3040 (2021)
   PUBMED   33961781
REFERENCE   2  (bases 1 to 375)
  AUTHORS   Talib,E.A. and Outten,C.E.
  TITLE     Iron-sulfur cluster biogenesis, trafficking, and signaling: Roles
            for CGFS glutaredoxins and BolA proteins
  JOURNAL   Biochim Biophys Acta Mol Cell Res 1868 (1), 118847 (2021)
   PUBMED   32910989
  REMARK    Review article
REFERENCE   3  (bases 1 to 375)
  AUTHORS   Frey,A.G., Palenchar,D.J., Wildemann,J.D. and Philpott,C.C.
  TITLE     A Glutaredoxin.BolA Complex Serves as an Iron-Sulfur Cluster
            Chaperone for the Cytosolic Cluster Assembly Machinery
  JOURNAL   J Biol Chem 291 (43), 22344-22356 (2016)
   PUBMED   27519415
REFERENCE   4  (bases 1 to 375)
  AUTHORS   Banci,L., Camponeschi,F., Ciofi-Baffoni,S. and Muzzioli,R.
  TITLE     Elucidating the Molecular Function of Human BOLA2 in GRX3-Dependent
            Anamorsin Maturation Pathway
  JOURNAL   J Am Chem Soc 137 (51), 16133-16143 (2015)
   PUBMED   26613676
REFERENCE   5  (bases 1 to 375)
  AUTHORS   Willems,P., Wanschers,B.F., Esseling,J., Szklarczyk,R., Kudla,U.,
            Duarte,I., Forkink,M., Nooteboom,M., Swarts,H., Gloerich,J.,
            Nijtmans,L., Koopman,W. and Huynen,M.A.
  TITLE     BOLA1 is an aerobic protein that prevents mitochondrial morphology
            changes induced by glutathione depletion
  JOURNAL   Antioxid Redox Signal 18 (2), 129-138 (2013)
   PUBMED   22746225
REFERENCE   6  (bases 1 to 375)
  AUTHORS   Li,H., Mapolelo,D.T., Randeniya,S., Johnson,M.K. and Outten,C.E.
  TITLE     Human glutaredoxin 3 forms [2Fe-2S]-bridged complexes with human
            BolA2
  JOURNAL   Biochemistry 51 (8), 1687-1696 (2012)
   PUBMED   22309771
REFERENCE   7  (bases 1 to 375)
  AUTHORS   Vaquerizas,J.M., Kummerfeld,S.K., Teichmann,S.A. and Luscombe,N.M.
  TITLE     A census of human transcription factors: function, expression and
            evolution
  JOURNAL   Nat Rev Genet 10 (4), 252-263 (2009)
   PUBMED   19274049
  REMARK    Review article
REFERENCE   8  (bases 1 to 375)
  AUTHORS   Zhou,Y.B., Cao,J.B., Wan,B.B., Wang,X.R., Ding,G.H., Zhu,H.,
            Yang,H.M., Wang,K.S., Zhang,X. and Han,Z.G.
  TITLE     hBolA, novel non-classical secreted proteins, belonging to
            different BolA family with functional divergence
  JOURNAL   Mol Cell Biochem 317 (1-2), 61-68 (2008)
   PUBMED   18548201
REFERENCE   9  (bases 1 to 375)
  AUTHORS   Kasai,T., Inoue,M., Koshiba,S., Yabuki,T., Aoki,M., Nunokawa,E.,
            Seki,E., Matsuda,T., Matsuda,N., Tomo,Y., Shirouzu,M., Terada,T.,
            Obayashi,N., Hamana,H., Shinya,N., Tatsuguchi,A., Yasuda,S.,
            Yoshida,M., Hirota,H., Matsuo,Y., Tani,K., Suzuki,H., Arakawa,T.,
            Carninci,P., Kawai,J., Hayashizaki,Y., Kigawa,T. and Yokoyama,S.
  TITLE     Solution structure of a BolA-like protein from Mus musculus
  JOURNAL   Protein Sci 13 (2), 545-548 (2004)
   PUBMED   14718656
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC137532.1 and AC106782.5.
            
            On May 17, 2019 this sequence version replaced NM_001039182.3.
            
            Summary: This gene is located within a region of a segmental
            duplication on chromosome 16 and is identical to BOLA2 (bolA family
            member 2). The product of this gene belongs to a family of proteins
            that are widely conserved and may be involved in iron maturation.
            Alternative splicing results in multiple transcript variants.
            [provided by RefSeq, Feb 2016].
            
            Transcript Variant: This variant (1) represents the longer
            transcript and encodes the longer isoform (1).
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1163655.446162.1,
                                           SRR7410570.599686.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000651894.2/ ENSP00000498355.1
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-356               BC137532.1         328-683
            357-375             AC106782.5         1974-1992           c
FEATURES             Location/Qualifiers
     source          1..375
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
                     /map="16p11.2"
     gene            1..375
                     /gene="BOLA2B"
                     /gene_synonym="BOLA2"
                     /note="bolA family member 2B"
                     /db_xref="GeneID:654483"
                     /db_xref="HGNC:HGNC:32479"
     exon            1..134
                     /gene="BOLA2B"
                     /gene_synonym="BOLA2"
                     /inference="alignment:Splign:2.1.0"
     CDS             72..332
                     /gene="BOLA2B"
                     /gene_synonym="BOLA2"
                     /note="isoform 1 is encoded by transcript variant 1;
                     bolA-like protein 2B; BolA-like protein 2 member B; bolA
                     homolog 2B"
                     /codon_start=1
                     /product="bolA-like protein 2 isoform 1"
                     /protein_id="NP_001034271.2"
                     /db_xref="CCDS:CCDS32430.2"
                     /db_xref="GeneID:654483"
                     /db_xref="HGNC:HGNC:32479"
                     /translation="MELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKF
                     EGKPLLQRHRLVNACLAEELPHIHAFEQKTLTPDQWARERQK"
     misc_feature    72..74
                     /gene="BOLA2B"
                     /gene_synonym="BOLA2"
                     /note="N-acetylmethionine.
                     /evidence=ECO:0000269|PubMed:12665801; propagated from
                     UniProtKB/Swiss-Prot (Q9H3K6.1); acetylation site"
     exon            135..232
                     /gene="BOLA2B"
                     /gene_synonym="BOLA2"
                     /inference="alignment:Splign:2.1.0"
     exon            233..375
                     /gene="BOLA2B"
                     /gene_synonym="BOLA2"
                     /inference="alignment:Splign:2.1.0"
     regulatory      354..359
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BOLA2B"
                     /gene_synonym="BOLA2"
                     /note="hexamer: ATTAAA"
     polyA_site      375
                     /gene="BOLA2B"
                     /gene_synonym="BOLA2"
                     /note="major polyA site"
ORIGIN      
        1 aaggtagcgt ggccggcgcc cgagctgggg ttgtgtccct gctgggctgc cgttccagct
       61 ggactgccgc catggaactc agcgccgaat acctccgcga gaagctgcag cgggacctgg
      121 aggcggagca tgtggaggtg gaggacacga ccctcaaccg ttgctcctgt agcttccgag
      181 tcctggtggt gtcggccaag ttcgagggga aaccgctgct tcagagacac aggctggtga
      241 acgcgtgcct agcagaagag ctcccgcaca tccatgcctt tgaacagaaa accctgaccc
      301 cagaccagtg ggcacgtgag cgacagaaat gagggactgg gatctgcaca gccattaaat
      361 tataaatctg gacca
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.