LOCUS NM_001183941 777 bp mRNA linear PLN 17-DEC-2024
DEFINITION Saccharomyces cerevisiae S288C histone H1 (HHO1), partial mRNA.
ACCESSION NM_001183941
VERSION NM_001183941.1
DBLINK BioProject: PRJNA128
KEYWORDS RefSeq.
SOURCE Saccharomyces cerevisiae S288C
ORGANISM Saccharomyces cerevisiae S288C
Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
Saccharomyces.
REFERENCE 1 (bases 1 to 777)
AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
Weng,S. and Cherry,J.M.
TITLE New data and collaborations at the Saccharomyces Genome Database:
updated reference genome, alleles, and the Alliance of Genome
Resources
JOURNAL Genetics 220 (4) (2022)
PUBMED 34897464
REFERENCE 2 (bases 1 to 777)
AUTHORS Bussey,H., Storms,R.K., Ahmed,A., Albermann,K., Allen,E.,
Ansorge,W., Araujo,R., Aparicio,A., Barrell,B., Badcock,K.,
Benes,V., Botstein,D., Bowman,S., Bruckner,M., Carpenter,J.,
Cherry,J.M., Chung,E., Churcher,C., Coster,F., Davis,K.,
Davis,R.W., Dietrich,F.S., Delius,H., DiPaolo,T., Hani,J. et al.
TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI
JOURNAL Nature 387 (6632 SUPPL), 103-105 (1997)
PUBMED 9169875
REFERENCE 3 (bases 1 to 777)
AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
Oliver,S.G.
TITLE Life with 6000 genes
JOURNAL Science 274 (5287), 546 (1996)
PUBMED 8849441
REFERENCE 4 (bases 1 to 777)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 5 (bases 1 to 777)
CONSRTM Saccharomyces Genome Database
TITLE Direct Submission
JOURNAL Submitted (16-JAN-2015) Department of Genetics, Stanford
University, Stanford, CA 94305-5120, USA
REMARK Protein update by submitter
REFERENCE 6 (bases 1 to 777)
CONSRTM Saccharomyces Genome Database
TITLE Direct Submission
JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford
University, Stanford, CA 94305-5120, USA
REMARK Sequence update by submitter
REFERENCE 7 (bases 1 to 777)
CONSRTM Saccharomyces Genome Database
TITLE Direct Submission
JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford
University, Stanford, CA 94305-5120, USA
COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record
is derived from an annotated genomic sequence (NC_001148).
##Genome-Annotation-Data-START##
Annotation Provider :: SGD
Annotation Status :: Full Annotation
Annotation Version :: R64-4-1
URL :: http://www.yeastgenome.org/
##Genome-Annotation-Data-END##
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..777
/organism="Saccharomyces cerevisiae S288C"
/mol_type="mRNA"
/strain="S288C"
/db_xref="taxon:559292"
/chromosome="XVI"
gene <1..>777
/gene="HHO1"
/locus_tag="YPL127C"
/db_xref="GeneID:855976"
CDS 1..777
/gene="HHO1"
/locus_tag="YPL127C"
/experiment="EXISTENCE:direct assay:GO:0000785 chromatin
[PMID:22586276]"
/experiment="EXISTENCE:direct assay:GO:0003677 DNA binding
[PMID:11574687]"
/experiment="EXISTENCE:direct assay:GO:0005634 nucleus
[PMID:11914276|PMID:9046096]"
/experiment="EXISTENCE:mutant phenotype:GO:0006355
regulation of DNA-templated transcription [PMID:11574687]"
/experiment="EXISTENCE:mutant phenotype:GO:0030261
chromosome condensation [PMID:22586276]"
/experiment="EXISTENCE:mutant phenotype:GO:0043934
sporulation [PMID:22586276]"
/experiment="EXISTENCE:mutant phenotype:GO:0045910
negative regulation of DNA recombination [PMID:12820979]"
/experiment="EXISTENCE:mutant phenotype:GO:2000779
regulation of double-strand break repair [PMID:31821952]"
/note="Histone H1, linker histone with roles in meiosis
and sporulation; decreasing levels early in sporulation
may promote meiosis, and increasing levels during
sporulation facilitate compaction of spore chromatin;
binds to promoters and within genes in mature spores; may
be recruited by Ume6p to promoter regions, contributing to
transcriptional repression outside of meiosis; suppresses
DNA repair involving homologous recombination"
/codon_start=1
/product="histone H1"
/protein_id="NP_015198.1"
/db_xref="GeneID:855976"
/db_xref="SGD:S000006048"
/translation="MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKTTAKKEEASS
KSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASNFDLYFNNAIKKGVEAGD
FEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQAATSVSATASKAKAASTKLAPKKVV
KKKSPTVTAKKASSPSSLTYKEMILKSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSS
NFDYLFNSAIKKCVENGELVQPKGPSGIIKLNKKKVKLST"
ORIGIN
1 atggcaccca agaaatccac taccaagacc acaagtaagg gcaagaagcc tgcaaccagc
61 aaaggcaagg agaaatcaac ttccaaggcc gctatcaaga aaaccacggc aaaaaaggag
121 gaagcttcct ccaagagtta cagggagttg atcattgaag ggctcacggc tttgaaggaa
181 cgtaagggat ccagtcgtcc ggcactcaag aagtttatca aggaaaacta cccgatcgtc
241 ggatccgcaa gcaactttga tttgtacttc aacaatgcca taaagaaggg tgtggaggcc
301 ggcgattttg aacagccaaa gggacccgct ggtgctgtga aactggccaa gaagaaatct
361 ccagaagtaa agaaagaaaa agaggtcagt ccaaaaccca agcaagccgc cacttctgtg
421 agtgcaaccg catcaaaagc gaaagccgca tccacgaagc tagcgccaaa gaaagtagtg
481 aaaaaaaaat cgcctactgt taccgccaag aaggcctctt cgccttcttc attgacctac
541 aaggaaatga tccttaaaag catgcctcaa cttaatgacg gtaagggctc cagccgtatc
601 gttttaaaga agtatgtcaa ggacactttc tcctccaagt tgaaaacaag ctcaaatttt
661 gactatctgt tcaatagcgc tatcaagaaa tgtgttgaaa acggcgagtt agtgcaacca
721 aagggcccct ccggcattat taaactaaac aagaagaagg tcaaactctc cacgtaa
//