LOCUS NM_001359012 3321 bp mRNA linear ROD 26-OCT-2024
DEFINITION Mus musculus ASH2 like histone lysine methyltransferase complex
subunit (Ash2l), transcript variant 4, mRNA.
ACCESSION NM_001359012 XM_011242135
VERSION NM_001359012.1
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 3321)
AUTHORS Wang,Q., Zeng,S., Liang,Y., Zhou,R. and Wang,D.
TITLE ASH2L Mediates Epidermal Differentiation and Hair Follicle
Morphogenesis through H3K4me3 Modification
JOURNAL J Invest Dermatol 144 (11), 2406-2416 (2024)
PUBMED 38582368
REMARK GeneRIF: ASH2L Mediates Epidermal Differentiation and Hair Follicle
Morphogenesis through H3K4me3 Modification.
REFERENCE 2 (bases 1 to 3321)
AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
Jackson,S.P. and Balmus,G.
CONSRTM Sanger Mouse Genetics Project
TITLE Genetic determinants of micronucleus formation in vivo
JOURNAL Nature 627 (8002), 130-136 (2024)
PUBMED 38355793
REFERENCE 3 (bases 1 to 3321)
AUTHORS Zhong,W., Dong,Y.J., Hong,C., Li,Y.H., Xiao,C.X., Liu,X.H. and
Chang,J.
TITLE ASH2L upregulation contributes to diabetic endothelial dysfunction
in mice through STEAP4-mediated copper uptake
JOURNAL Acta Pharmacol Sin 45 (3), 558-569 (2024)
PUBMED 37903897
REMARK GeneRIF: ASH2L upregulation contributes to diabetic endothelial
dysfunction in mice through STEAP4-mediated copper uptake.
REFERENCE 4 (bases 1 to 3321)
AUTHORS Su,Z., Wang,J., Xiao,C., Zhong,W., Liu,J., Liu,X. and Zhu,Y.Z.
TITLE Functional role of Ash2l in oxLDL induced endothelial dysfunction
and atherosclerosis
JOURNAL Cell Mol Life Sci 81 (1), 62 (2024)
PUBMED 38280036
REMARK GeneRIF: Functional role of Ash2l in oxLDL induced endothelial
dysfunction and atherosclerosis.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 3321)
AUTHORS Zhu,X., Ma,Z., Xie,F. and Wang,J.
TITLE ASH2L, Core Subunit of H3K4 Methylation Complex, Regulates
Amelogenesis
JOURNAL J Dent Res 103 (1), 81-90 (2024)
PUBMED 37990471
REMARK GeneRIF: ASH2L, Core Subunit of H3K4 Methylation Complex, Regulates
Amelogenesis.
REFERENCE 6 (bases 1 to 3321)
AUTHORS Cobellis,G., Nicolaus,G., Iovino,M., Romito,A., Marra,E.,
Barbarisi,M., Sardiello,M., Di Giorgio,F.P., Iovino,N., Zollo,M.,
Ballabio,A. and Cortese,R.
TITLE Tagging genes with cassette-exchange sites
JOURNAL Nucleic Acids Res 33 (4), e44 (2005)
PUBMED 15741177
REMARK Publication Status: Online-Only
REFERENCE 7 (bases 1 to 3321)
AUTHORS Hughes,C.M., Rozenblatt-Rosen,O., Milne,T.A., Copeland,T.D.,
Levine,S.S., Lee,J.C., Hayes,D.N., Shanmugam,K.S.,
Bhattacharjee,A., Biondi,C.A., Kay,G.F., Hayward,N.K., Hess,J.L.
and Meyerson,M.
TITLE Menin associates with a trithorax family histone methyltransferase
complex and with the hoxc8 locus
JOURNAL Mol Cell 13 (4), 587-597 (2004)
PUBMED 14992727
REFERENCE 8 (bases 1 to 3321)
AUTHORS Piao,Y., Ko,N.T., Lim,M.K. and Ko,M.S.
TITLE Construction of long-transcript enriched cDNA libraries from
submicrogram amounts of total RNAs by a universal PCR amplification
method
JOURNAL Genome Res 11 (9), 1553-1558 (2001)
PUBMED 11544199
REFERENCE 9 (bases 1 to 3321)
AUTHORS Araki,K., Imaizumi,T., Sekimoto,T., Yoshinobu,K., Yoshimuta,J.,
Akizuki,M., Miura,K., Araki,M. and Yamamura,K.
TITLE Exchangeable gene trap using the Cre/mutated lox system
JOURNAL Cell Mol Biol (Noisy-le-grand) 45 (5), 737-750 (1999)
PUBMED 10512203
REFERENCE 10 (bases 1 to 3321)
AUTHORS Ikegawa,S., Isomura,M., Koshizuka,Y. and Nakamura,Y.
TITLE Cloning and characterization of ASH2L and Ash2l, human and mouse
homologs of the Drosophila ash2 gene
JOURNAL Cytogenet Cell Genet 84 (3-4), 167-172 (1999)
PUBMED 10393421
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC122752.10.
On Dec 16, 2017 this sequence version replaced XM_011242135.2.
Transcript Variant: This variant (4) represents the longest
transcript and encodes the longest protein (isoform d).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
RNAseq introns :: single sample supports all introns SAMN01164134,
SAMN01164135 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-206 AC122752.10 53152-53357 c
207-270 AC122752.10 52582-52645 c
271-416 AC122752.10 52313-52458 c
417-505 AC122752.10 48570-48658 c
506-600 AC122752.10 47530-47624 c
601-696 AC122752.10 46321-46416 c
697-792 AC122752.10 45210-45305 c
793-868 AC122752.10 43843-43918 c
869-886 AC122752.10 42945-42962 c
887-980 AC122752.10 41336-41429 c
981-1198 AC122752.10 39744-39961 c
1199-1366 AC122752.10 35709-35876 c
1367-1560 AC122752.10 35265-35458 c
1561-1653 AC122752.10 32196-32288 c
1654-1752 AC122752.10 31116-31214 c
1753-1812 AC122752.10 30174-30233 c
1813-3321 AC122752.10 28570-30078 c
FEATURES Location/Qualifiers
source 1..3321
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="8"
/map="8 14.17 cM"
gene 1..3321
/gene="Ash2l"
/note="ASH2 like histone lysine methyltransferase complex
subunit"
/db_xref="GeneID:23808"
/db_xref="MGI:MGI:1344416"
exon 1..206
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
CDS 31..1920
/gene="Ash2l"
/note="isoform d is encoded by transcript variant 4;
set1/Ash2 histone methyltransferase complex subunit ASH2;
ASH2-like protein; ash2 (absent, small, or homeotic)-like"
/codon_start=1
/product="set1/Ash2 histone methyltransferase complex
subunit ASH2 isoform d"
/protein_id="NP_001345941.1"
/db_xref="GeneID:23808"
/db_xref="MGI:MGI:1344416"
/translation="MAAAGAGPGPGVSAGPGPGAAASATTAEDRETEPVAAGAGEGPS
AAPGAEPSSGEAESGDANLVDVSGLETESSNGKDTLEGTGDTSEVMDTQAGSVDEENG
RQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANL
KEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNI
VKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSASG
NLNGGATLGGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLE
HPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQ
LKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQA
PLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYK
DKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYRDIFEGVYFPA
ISLYKSCTVSINFGPSFKYPPKDLTYHPMSDMGWGAVVEHTLADVLYHVETEVDGRRS
PPWEP"
misc_feature 31..327
/gene="Ash2l"
/note="propagated from UniProtKB/Swiss-Prot (Q91X20.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 217..546
/gene="Ash2l"
/note="propagated from UniProtKB/Swiss-Prot (Q91X20.1);
Region: DNA-binding. /evidence=ECO:0000250"
misc_feature 316..318
/gene="Ash2l"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:21183079; propagated from
UniProtKB/Swiss-Prot (Q91X20.1); phosphorylation site"
misc_feature 919..921
/gene="Ash2l"
/note="Asymmetric dimethylarginine, by PRMT1 and PRMT5.
/evidence=ECO:0000250|UniProtKB:Q9UBL3; propagated from
UniProtKB/Swiss-Prot (Q91X20.1); methylation site"
misc_feature 979..1917
/gene="Ash2l"
/note="propagated from UniProtKB/Swiss-Prot (Q91X20.1);
Region: Interaction with RBBP5.
/evidence=ECO:0000250|UniProtKB:Q9UBL3"
misc_feature 979..981
/gene="Ash2l"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:Q9UBL3; propagated from
UniProtKB/Swiss-Prot (Q91X20.1); phosphorylation site"
exon 207..270
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 271..416
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 417..505
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 506..600
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 601..696
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 697..792
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 793..868
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 869..886
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 887..980
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 981..1198
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 1199..1366
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 1367..1560
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 1561..1653
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 1654..1752
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 1753..1812
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
exon 1813..3321
/gene="Ash2l"
/inference="alignment:Splign:2.1.0"
regulatory 1978..1983
/regulatory_class="polyA_signal_sequence"
/gene="Ash2l"
/note="hexamer: TATAAA"
polyA_site 2003
/gene="Ash2l"
regulatory 2422..2427
/regulatory_class="polyA_signal_sequence"
/gene="Ash2l"
/note="hexamer: AATAAA"
polyA_site 2451
/gene="Ash2l"
/note="major polyA site"
regulatory 2769..2774
/regulatory_class="polyA_signal_sequence"
/gene="Ash2l"
/note="hexamer: AATACA"
polyA_site 2801
/gene="Ash2l"
regulatory 3299..3304
/regulatory_class="polyA_signal_sequence"
/gene="Ash2l"
/note="hexamer: AATAAA"
polyA_site 3317
/gene="Ash2l"
ORIGIN
1 attctcgcga gagcttggga aggagcagcg atggcggcgg ctggagcggg tcctggtccg
61 ggagtcagcg ccggccctgg tcccggagcc gctgcaagtg ccacaacggc ggaggaccga
121 gagacagagc cggtggccgc gggggctggc gaggggccgt cagccgcccc gggagcggag
181 cccagctccg gagaggccga aagtggggat gcaaacttgg ttgatgtaag tggtctggag
241 acagaatctt ctaatggaaa agatactttg gaaggtaccg gagacacttc agaagtgatg
301 gatacccagg cgggctctgt ggatgaggag aatgggcggc agttgggaga agtggagttg
361 cagtgtggga tatgtacaaa atggttcacc gctgacacct ttggaataga cacgtcgtca
421 tgtctgcctt ttatgaccaa ctacagcttc cattgcaatg tgtgccatca cagtgggaat
481 acctactttc tccggaagca agcaaattta aaagaaatgt gccttagtgc cttggcgaat
541 ttgacgtggc agtctcgaac acaggatgaa catccaaaaa ccatgttctc caaagataag
601 gatattatac catttattga taaatactgg gaatgtatga caaccagaca gagacctgga
661 aaaatgactt ggcccaataa cattgtcaaa acaatgagta aggaaagaga tgtgttcttg
721 gtaaaggaac accctgaccc aggaagcaaa gacccagaag aagattaccc caagtttgga
781 cttttggatc aggatcttag taatattggt cctgcttatg acaaccagaa acaaagcagt
841 gctgtgtctg ctagtgggaa cctaaatggt ggagccactt tgggaggggg gatcgcagcc
901 ggaagcagtg ggaaaggaag aggagccaag cgtaagcagc aagatggagg gacaacaggg
961 accaccaaga aggccagaag tgatccttta ttttctgctc agcgtctccc tcctcatggc
1021 tatcctttgg aacatccatt taacaaagat ggctatcggt atattcttgc tgagcccgat
1081 cctcatgccc ccgacccgga gaagcttgaa cttgactgct gggcgggaaa gcctattcct
1141 ggagaccttt acagagcctg cttatatgaa cgagtcttgt tagccctaca tgatcgagct
1201 ccccagttaa agatctctga tgaccggctg accgtggttg gagagaaggg ctactccatg
1261 gtccgggcct ctcatggggt acgcaaaggg gcctggtact ttgaaatcac tgtggatgag
1321 atgcccccag acactgctgc caggctgggc tggtcccagc ccttaggtaa cctccaagct
1381 cccttaggct atgataagtt tagctattct tggcggagca agaaaggcac caagttccac
1441 cagtccattg gcaagcacta ttcgtctggc tacggacaag gggacgtcct agggttctat
1501 atcaaccttc ccgaagacac agagacagcc aagtcactgc cggacaccta caaagataag
1561 gctttgataa agttcaagag ttatttgtat tttgaagaaa aagactttgt ggacaaagca
1621 gagaagagcc taaaacagac cccccatagt gagataatat tttataaaaa tggtgtcaat
1681 cagggtgtgg cttacagaga tatttttgaa ggagtttact tcccagccat ctcactgtac
1741 aagagctgca cggtttccat taactttgga ccatccttca aataccctcc aaaggatctc
1801 acgtaccacc ctatgagtga catgggctgg ggcgctgtgg tagaacacac actggctgat
1861 gttttgtatc acgtggagac agaagtggac ggaagacgta gtccaccctg ggaaccctaa
1921 ccagtccttg cttctggtga cactgtaaaa taatcctggg ggttttgttt ttgtttttat
1981 aaagtgtcaa atgttttcca agagatgctg cagtacactt tgatcaaggt aaaagggtgg
2041 gtgggactgc agcagtgcct gctcttcagc atccctgccc cacacaacta cttactctga
2101 gtgccataaa tcagccgctc cctgtaaggc tgctgctgtg cccagacctg ccagggagga
2161 cctgttactt tcctgtgtct gtgtgttcca aagagcgagt aatcatgctc agacagcttg
2221 cttgaggatg ttggatcccc tggtttctgg ggaggcaagc ttgtttgagt ggctgaaatc
2281 aatggcattc cattccagag cagtctaaag gcagtctttt tggtgtggag tttggggatc
2341 atctgggaag ctagtgggtt ctataaacta taattgtgaa aggaatatgc ctacagggtt
2401 taaaagatag atctttcctc caataaaact tgttttcaag cttgtatggt acttggcttc
2461 actggaagtg aagttcctgt tgaccctgtt agcagtgtga gcagtgtgac ggggacaaca
2521 ctggcagggt gggacaggcg cttttattgc tgtcctcccc gggtcaccag gcgctttcac
2581 tgccctgtgt acagtggact ctcagggaga gcaagactgt agcaggcctc cagtccgtgt
2641 cttggaactt ggtgctgata tgtgcggctt gtcctcttgc ctgcctttct agtagccagc
2701 caggggttag gatcaaagaa tgatgaggag cctgccttac gaggatgcct taatgacctc
2761 cgattttaaa tacataagtc tgtggcaaat gcaaaatcct acactgacct aaagacttcc
2821 cttttttgtg tagccttttt tgtttgtttg ctttgttttg ttttaactta agtactagtg
2881 atataaagtg actaaccagg agctaggtag gatgcagaat tatattctaa gtattttgtt
2941 ttgctattta agaaatttcc caagccgggc gtggtggcgc acgcctttaa tcccagcact
3001 tgggaggcag aggcagattt ctgagtttga ggccagcctg gtctacaaag tgagttccag
3061 gacagccagg gctacacaga gaaaccctgt ctcgaaaaaa ccaaaaaaca acaacaacaa
3121 aaaaaagaaa tttcccgggc tggcgagatg gctcagtggt taagagcacc aactgctctt
3181 ctgaaggtcc cgagttcaaa tcccaacaac cacatgatgg ctcacaacca tccataacga
3241 gatctgatgc cctcttctgg agtatctgag gacagctaca gtgtacttac atataataaa
3301 taaatcttta aaagaaagaa a
//