Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_001373309.4
FASTA Graphics
LOCUS NM_001373309 1858 bp mRNA linear INV 04-DEC-2024 DEFINITION Caenorhabditis elegans G-protein coupled receptors family 1 profile domain-containing protein (gnrr-4), mRNA. ACCESSION NM_001373309 VERSION NM_001373309.4 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 1858) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 1858) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1858) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (17-OCT-2024) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 1858) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003284). On May 27, 2020 this sequence version replaced NM_001373309.3. FEATURES Location/Qualifiers source 1..1858 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="X" gene 1..1858 /gene="gnrr-4" /locus_tag="CELE_C41G11.4" /db_xref="GeneID:180841" /db_xref="WormBase:WBGene00016570" CDS 60..1595 /gene="gnrr-4" /locus_tag="CELE_C41G11.4" /standard_name="C41G11.4c" /note="Confirmed by transcript evidence" /codon_start=1 /product="G-protein coupled receptors family 1 profile domain-containing protein" /protein_id="NP_001359929.1" /db_xref="GeneID:180841" /db_xref="WormBase:WBGene00016570" /translation="MSEATQQETQRVELSFSYTLELWMYGIAFCVGLPAFIFTVVRLA RSRSSRQHLVLAARLFSYKISLSVADCIVLFIYAPTQFAWIHSYWWFGGDIGCRLFKF ISTFGFHLTANMQVLVAADRLLITAKMNRVTRNIKKRQYNTRLSLAAAWILALICAGP QLILFRQKTTPQGYPQCISIWTEHRVDFYDRLELLEQYAYMQHELANKSPIYFFENGT LRYAKEDFPSEPGFTLEELHTNNRNWLYLERLYNVLHLATICVIPYAMELICYTLILY ILKGASKGRFVSLSDIVKDIFCCCKRARQHESPIESNVTQESDNLMARVPSKTKRLQN IAPEGDMERRRAASVDVPMRIKNSSSLTVCIDENGSATAATRPEVTPQEQEPETRTQA FKRRVWNFLLDLFHNGSEGSVHFNGHKTELRLPNLTKGEARRQSAPASARSNTLWVVT VDTARRNARWKAFIMLSLNLVFWAPYCILAITSSVIISQYLTNFQFVNALVTFNAVSN IIL" ORIGIN 1 agggtgaatg ctcttctgat catttgtgcc aaactaacga gtttgacgca tcggaaacga 61 tgagcgaggc cacacaacaa gagacccaga gagttgagtt gagcttcagt tatacgcttg 121 agctatggat gtatggaatc gcgttctgcg tgggattgcc agctttcatt ttcacagtcg 181 ttcgactcgc tcgatcacgc tcctcacgac aacatctcgt gttggctgct cgcctgtttt 241 cgtacaaaat cagtttgtct gtagcggact gcatcgttct ctttatctac gctccaactc 301 agtttgcatg gattcactca tactggtggt tcggcggtga catcggatgc aggctattca 361 aatttatatc aacatttggt tttcatttaa ccgctaatat gcaagtactg gtagcggctg 421 atcgtttgct catcacggca aaaatgaaca gagttacaag aaatattaaa aaacgacagt 481 acaatacgcg actttctcta gcagcagctt ggatccttgc actgatttgt gccgggcctc 541 aactcattct cttcaggcaa aaaactactc cacaaggata ccctcaatgt atttctattt 601 ggactgagca tcgtgtagac ttttatgacc ggctagaact cttggagcaa tatgcataca 661 tgcagcacga gcttgcaaac aagtcaccaa tctatttttt cgaaaatgga acattgaggt 721 acgcgaagga agacttccca tccgagccag gattcacttt agaggagctg cacaccaaca 781 acagaaattg gctttatttg gaaaggcttt ataatgtttt acatcttgca acaatctgtg 841 taattccata tgcaatggag ttgatatgtt acacactgat tttgtacatt ttgaagggag 901 catctaaagg acgatttgtt agtctgtctg atattgtgaa agacattttc tgctgctgta 961 aacgtgcaag gcaacacgag tctccaatcg agtcaaatgt tacacaagaa tccgacaatt 1021 tgatggcccg tgttccttct aaaacgaaac gactgcagaa catcgcgccg gaaggcgata 1081 tggaacgtcg gcgagctgca tcggtagatg taccaatgag aattaaaaac tcatctagtc 1141 ttacagtatg cattgacgaa aatggctcag ctactgcagc gacaagacct gaagtgaccc 1201 cacaagagca ggaacctgaa accagaacgc aagctttcaa gcgtcgagtg tggaatttcc 1261 tgttagacct gttccacaac ggatcagaag gttcagttca tttcaacgga cataaaacag 1321 agcttcggtt accaaacctg acaaagggag aagcacgaag gcaaagcgct ccagcgagtg 1381 ctcgatcaaa cactctctgg gtggtcacag tggatacagc acgccggaac gctcggtgga 1441 aggcttttat catgctctcc ctcaatttgg tcttctgggc tccatactgc attttggcaa 1501 tcacgtcttc cgttatcatc tcgcaatatc tgacaaattt ccagtttgtc aatgcactgg 1561 tcacattcaa tgcagtttca aatattattt tataactaat aattattcca gtttttccat 1621 cttttcctat tacatagtac aatttttgcc aacacttgat ctcagcgtag tcccccaggc 1681 ctgagtaaaa ctcacacgag taattgagtt ctgaaatttt tcagtctagt ttttgttgta 1741 ttgcctaaat cccggtcagt gagcccgagt gaattcatat ttatcccagt accttgaatc 1801 aaaagttcat cacccggtaa aaacaaattg tattgttttg aaataaaaac gttcatca //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on