U.S. flag

An official website of the United States government

Homo sapiens ATPase H+ transporting V0 subunit a1 (ATP6V0A1), transcript variant 11, mRNA

NCBI Reference Sequence: NM_001378535.1

FASTA Graphics 

LOCUS       NM_001378535            4181 bp    mRNA    linear   PRI 07-APR-2024
DEFINITION  Homo sapiens ATPase H+ transporting V0 subunit a1 (ATP6V0A1),
            transcript variant 11, mRNA.
ACCESSION   NM_001378535
VERSION     NM_001378535.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4181)
  AUTHORS   Yamazaki,Y., Eura,Y. and Kokame,K.
  TITLE     V-ATPase V0a1 promotes Weibel-Palade body biogenesis through the
            regulation of membrane fission
  JOURNAL   Elife 10, e71526 (2021)
   PUBMED   34904569
  REMARK    GeneRIF: V-ATPase V0a1 promotes Weibel-Palade body biogenesis
            through the regulation of membrane fission.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4181)
  AUTHORS   Aoto,K., Kato,M., Akita,T., Nakashima,M., Mutoh,H., Akasaka,N.,
            Tohyama,J., Nomura,Y., Hoshino,K., Ago,Y., Tanaka,R., Epstein,O.,
            Ben-Haim,R., Heyman,E., Miyazaki,T., Belal,H., Takabayashi,S.,
            Ohba,C., Takata,A., Mizuguchi,T., Miyatake,S., Miyake,N.,
            Fukuda,A., Matsumoto,N. and Saitsu,H.
  TITLE     ATP6V0A1 encoding the a1-subunit of the V0 domain of vacuolar
            H+-ATPases is essential for brain development in humans and mice
  JOURNAL   Nat Commun 12 (1), 2107 (2021)
   PUBMED   33833240
  REMARK    GeneRIF: ATP6V0A1 encoding the a1-subunit of the V0 domain of
            vacuolar H(+)-ATPases is essential for brain development in humans
            and mice.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 4181)
  AUTHORS   Wang,L., Wu,D., Robinson,C.V., Wu,H. and Fu,T.M.
  TITLE     Structures of a Complete Human V-ATPase Reveal Mechanisms of Its
            Assembly
  JOURNAL   Mol Cell 80 (3), 501-511 (2020)
   PUBMED   33065002
REFERENCE   4  (bases 1 to 4181)
  AUTHORS   Vasanthakumar,T. and Rubinstein,J.L.
  TITLE     Structure and Roles of V-type ATPases
  JOURNAL   Trends Biochem Sci 45 (4), 295-307 (2020)
   PUBMED   32001091
  REMARK    Review article
REFERENCE   5  (bases 1 to 4181)
  AUTHORS   Brisson,L., Banski,P., Sboarina,M., Dethier,C., Danhier,P.,
            Fontenille,M.J., Van Hee,V.F., Vazeille,T., Tardy,M., Falces,J.,
            Bouzin,C., Porporato,P.E., Frederick,R., Michiels,C., Copetti,T.
            and Sonveaux,P.
  TITLE     Lactate Dehydrogenase B Controls Lysosome Activity and Autophagy in
            Cancer
  JOURNAL   Cancer Cell 30 (3), 418-431 (2016)
   PUBMED   27622334
REFERENCE   6  (bases 1 to 4181)
  AUTHORS   Finbow,M.E. and Harrison,M.A.
  TITLE     The vacuolar H+-ATPase: a universal proton pump of eukaryotes
  JOURNAL   Biochem J 324 (Pt 3) (Pt 3), 697-712 (1997)
   PUBMED   9210392
  REMARK    Review article
REFERENCE   7  (bases 1 to 4181)
  AUTHORS   Stevens,T.H. and Forgac,M.
  TITLE     Structure, function and regulation of the vacuolar (H+)-ATPase
  JOURNAL   Annu Rev Cell Dev Biol 13, 779-808 (1997)
   PUBMED   9442887
  REMARK    Review article
REFERENCE   8  (bases 1 to 4181)
  AUTHORS   Andresson,T., Sparkowski,J., Goldstein,D.J. and Schlegel,R.
  TITLE     Vacuolar H(+)-ATPase mutants transform cells and define a binding
            site for the papillomavirus E5 oncoprotein
  JOURNAL   J Biol Chem 270 (12), 6830-6837 (1995)
   PUBMED   7896830
REFERENCE   9  (bases 1 to 4181)
  AUTHORS   Brody,L.C., Abel,K.J., Castilla,L.H., Couch,F.J., McKinley,D.R.,
            Yin,G., Ho,P.P., Merajver,S., Chandrasekharappa,S.C., Xu,J. et al.
  TITLE     Construction of a transcription map surrounding the BRCA1 locus of
            human chromosome 17
  JOURNAL   Genomics 25 (1), 238-247 (1995)
   PUBMED   7774924
REFERENCE   10 (bases 1 to 4181)
  AUTHORS   Dautry-Varsat,A.
  TITLE     Receptor-mediated endocytosis: the intracellular journey of
            transferrin and its receptor
  JOURNAL   Biochimie 68 (3), 375-381 (1986)
   PUBMED   2874839
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC107993.9 and AC067852.23.
            
            Summary: This gene encodes a component of vacuolar ATPase
            (V-ATPase), a multisubunit enzyme that mediates acidification of
            eukaryotic intracellular organelles. V-ATPase dependent organelle
            acidification is necessary for such intracellular processes as
            protein sorting, zymogen activation, receptor-mediated endocytosis,
            and synaptic vesicle proton gradient generation. V-ATPase is
            composed of a cytosolic V1 domain and a transmembrane V0 domain.
            The V1 domain consists of three A and three B subunits, two G
            subunits plus the C, D, E, F, and H subunits. The V1 domain
            contains the ATP catalytic site. The V0 domain consists of five
            different subunits: a, c, c', c', and d. Additional isoforms of
            many of the V1 and V0 subunit proteins are encoded by multiple
            genes or alternatively spliced transcript variants. This gene
            encodes one of three A subunit proteins and the encoded protein is
            associated with clathrin-coated vesicles. Three transcript variants
            encoding different isoforms have been found for this gene.
            [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA2145544,
                              SAMEA2145743 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-86                AC107993.9         131280-131365
            87-250              AC107993.9         133250-133413
            251-329             AC107993.9         138831-138909
            330-427             AC107993.9         140412-140509
            428-556             AC107993.9         142492-142620
            557-639             AC107993.9         150062-150144
            640-766             AC107993.9         150865-150991
            767-849             AC107993.9         153069-153151
            850-943             AC107993.9         155440-155533
            944-1156            AC107993.9         159557-159769
            1157-1307           AC107993.9         162889-163039
            1308-1447           AC107993.9         166736-166875
            1448-1602           AC107993.9         167436-167590
            1603-1693           AC107993.9         168028-168118
            1694-1812           AC107993.9         171326-171444
            1813-2029           AC107993.9         173109-173325
            2030-2039           AC107993.9         173599-173608
            2040-2137           AC067852.23        176724-176821       c
            2138-2212           AC067852.23        175160-175234       c
            2213-2320           AC067852.23        170401-170508       c
            2321-2338           AC067852.23        169439-169456       c
            2339-2456           AC067852.23        164050-164167       c
            2457-2628           AC067852.23        163568-163739       c
            2629-4181           AC067852.23        155449-157001       c
FEATURES             Location/Qualifiers
     source          1..4181
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q21.2"
     gene            1..4181
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /note="ATPase H+ transporting V0 subunit a1"
                     /db_xref="GeneID:535"
                     /db_xref="HGNC:HGNC:865"
                     /db_xref="MIM:192130"
     exon            1..86
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            87..250
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     CDS             134..2722
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /EC_number="7.1.2.2"
                     /note="isoform 11 is encoded by transcript variant 11;
                     clathrin-coated vesicle/synaptic vesicle proton pump 116
                     kDa subunit; vacuolar proton translocating ATPase 116 kDa
                     subunit A; H(+)-transporting two-sector ATPase, 116 kDa
                     accessory protein A1; V-ATPase 116 kDa subunit a1;
                     V-ATPase subunit a1; ATPase, H+ transporting, lysosomal
                     non-catalytic accessory protein 1 (110/116kD);
                     vacuolar-type H(+)-ATPase 115 kDa subunit; V-type proton
                     ATPase 116 kDa subunit a; vacuolar proton pump subunit 1;
                     vacuolar adenosine triphosphatase subunit Ac116; ATPase,
                     H+ transporting, lysosomal V0 subunit a1; V-type proton
                     ATPase 116 kDa subunit a1; V-ATPase 116 kDa subunit a 1;
                     V-type proton ATPase 116 kDa subunit a 1"
                     /codon_start=1
                     /product="V-type proton ATPase 116 kDa subunit a 1 isoform
                     11"
                     /protein_id="NP_001365464.1"
                     /db_xref="CCDS:CCDS92319.1"
                     /db_xref="GeneID:535"
                     /db_xref="HGNC:HGNC:865"
                     /db_xref="MIM:192130"
                     /translation="MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDV
                     NVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFE
                     KIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPSEM
                     GRGTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKS
                     VFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTE
                     DHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQ
                     FALRRGTEHSGSTVPSILNRMQTNQTPPTYNKTNKFTYGFQNIVDAYGIGTYREINPA
                     PYTIITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYII
                     LLMGVFSMYTGLIYNDCFSKSLNIFGSSWSVRPMFTYNWTEETLRGNPVLQLNPALPG
                     VFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPL
                     NIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAHTSENAPSLLIHFINMFLFSYPESG
                     YSMLYSGQKGIQCFLVVVALLCVPWMLLFKPLVLRRQYLRRKHLEGQPVEAPVSPNPS
                     QQGLEAAAAATGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDADEPSEDEVFDFGD
                     TMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGL
                     VLFFFFTAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIR
                     EGKFEE"
     exon            251..329
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            330..427
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            428..556
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            557..639
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            640..766
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            767..849
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            850..943
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            944..1156
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            1157..1307
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            1308..1447
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            1448..1602
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            1603..1693
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            1694..1812
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            1813..2029
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            2030..2137
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            2138..2212
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            2213..2320
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            2321..2338
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            2339..2456
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            2457..2628
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     exon            2629..4181
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /inference="alignment:Splign:2.1.0"
     regulatory      4156..4161
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /note="hexamer: AATAAA"
     polyA_site      4181
                     /gene="ATP6V0A1"
                     /gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
                     Vph1; VPP1"
                     /note="major polyA site"
ORIGIN      
        1 acgtcgaagc gctgctcctg gagccgcgga gggtgcgggt ttggctgcgg tggtttctgt
       61 ggcggttgct gtggcggagt ttggaggttg gagagaaatc caggtactca ctagactggt
      121 accttctgcc accatggggg agcttttccg gagtgaagaa atgacactgg cccagctttt
      181 tctacagtca gaggctgctt attgttgtgt cagtgaatta ggagaacttg gaaaggttca
      241 gtttcgtgac ttaaatccag atgtgaatgt tttccaacgg aaatttgtga atgaagttag
      301 aagatgtgaa gaaatggatc gaaagcttcg atttgttgag aaagagataa gaaaagctaa
      361 cattccgatt atggacaccg gtgaaaaccc agaggttccc ttcccccggg acatgattga
      421 cttagaggcc aattttgaga agattgaaaa tgaactgaag gaaatcaaca caaaccagga
      481 agctctgaag agaaacttcc tggaactgac cgaattaaaa tttatacttc gcaaaactca
      541 gcaatttttt gatgagatgg cggatccaga cttgttggaa gagtcctcat ccctcttgga
      601 gccaagtgag atgggaagag gcactccttt aagacttggc ttcgtggctg gtgtcattaa
      661 ccgggagcgc atccctactt ttgagcgcat gctttggcgg gtatgccggg gaaatgtgtt
      721 cctgcgacag gctgaaatcg agaaccccct ggaggatcct gtgactggcg actacgtgca
      781 caagtctgtg tttatcattt tcttccaagg cgatcagctg aaaaacagag tcaagaaaat
      841 ctgtgaaggg ttccgagcct cactctatcc ctgtcctgag acaccacagg agaggaagga
      901 aatggcttct ggagtgaata ccaggattga tgatctccaa atggttctga atcaaacgga
      961 ggatcaccgc cagagggttc tgcaggcagc tgctaagaac atccgtgtct ggttcatcaa
     1021 agtgcggaag atgaaggcca tctatcacac cctgaacctg tgcaacatag atgtgactca
     1081 gaaatgcttg attgcagagg tctggtgccc tgtcaccgac cttgactcca tccagtttgc
     1141 actcagaagg ggcacggaac acagtggttc cactgtacct tccattttga acaggatgca
     1201 gacaaaccag actcccccaa cctataacaa aaccaacaag tttacctatg gctttcagaa
     1261 catagtagat gcttatggaa ttggaactta ccgagagata aatccagctc cgtatactat
     1321 tatcacgttc ccttttctat ttgctgtgat gtttggagac ttcggtcatg gcattttaat
     1381 gacccttttt gctgtgtgga tggtactgag ggagagccgg atcctttccc agaagaatga
     1441 gaatgagatg tttagcactg tgttcagtgg tcgatacatt attttattga tgggtgtgtt
     1501 ctccatgtac actggcctca tctacaatga ttgcttttcc aagtctctta atatctttgg
     1561 gtcatcctgg agtgtacggc cgatgtttac ttataattgg actgaagaga cgcttcgggg
     1621 gaaccctgtt ctacagctga acccagccct ccctggagtg tttggtggac catacccttt
     1681 tggcattgat ccaatttgga acattgctac caataaactg acgttcttga actcctttaa
     1741 gatgaagatg tctgttatcc ttggtatcat ccatatgctg tttggagtca gcctgagtct
     1801 gttcaaccat atctatttca agaagcccct gaatatctac tttggattta ttcctgaaat
     1861 aatcttcatg acctctttgt ttggctattt ggttatcctt attttttaca agtggacggc
     1921 ctatgatgct catacctctg agaatgcacc aagccttctg atccatttca taaacatgtt
     1981 cctcttttcc tacccagagt ctggttattc aatgttgtat tctggacaga aaggaattca
     2041 gtgtttcctg gtagtggttg cactactgtg tgtaccttgg atgctgctgt ttaaaccatt
     2101 ggtccttcgc cgtcagtatt tgaggagaaa gcatttggaa gggcaacctg tggaggcccc
     2161 agtcagccca aacccgagcc aacagggact agaggcagca gcggctgcaa caggaactct
     2221 caactttggt gggatcaggg tgggcaacgg accgacagag gaggatgctg agattattca
     2281 gcatgaccag ctctccaccc actcagagga cgcagacgag ccttccgagg acgaagtgtt
     2341 tgactttggg gacaccatgg tccaccaggc catccacacc atcgagtact gcctgggctg
     2401 catctccaac actgcctcct acttgcggct ctgggccctc agcctcgctc atgcgcagct
     2461 gtctgaggtg ctttggacca tggtgatcca catcggcctg agcgtgaaga gcttggcggg
     2521 aggtttggtg ctgttcttct tcttcactgc ctttgccacc ctgaccgtgg ccatcctcct
     2581 gatcatggag ggcctctcgg cctttctcca cgcactgcgc ttacactggg ttgagttcca
     2641 gaataaattc tacagcggga ccggtttcaa gttcttaccc ttctccttcg agcatattcg
     2701 ggaagggaag tttgaagagt gagtccctgt gagggccgtg tgccccatgc taccctcccc
     2761 gcctccctcc acagtgatca gctgtgcctc tctgcctgtt ggttgtgatc tgtgggcacc
     2821 agctcattcg tgtcaccctg tctgtgagtc atttagatag aatagtcctc cttgggtctc
     2881 ccaccacccc tagctttgtg tgtagtgtag tgattttctg gctgtcactc atactcactg
     2941 ggcaccagcc ttgccctctt agcctccatc catccagaca gcccttccca cctcctggtg
     3001 gtgagccagt ctgcattccc acgccatccc aaagcccttt catcttcccc gtgcattgta
     3061 gatggaagga gcacccatgc cattcacatc tagactttga gttccctgca tctgccaccg
     3121 tagtttctag caggagtagt ggggggagta atacagattc ttccctagaa ggggacactg
     3181 gtaacatgtc ccactcttgg attagcaggg gtgggtccag gaagatgata tttgcgtctt
     3241 ttgcccaccc ccctggcatt cagctggacc caactaggcc atcatgagtg gcttctccct
     3301 gtcatcccca ggggtcatag gatatctaca ccgcctttct gaccccaccc tgcactccca
     3361 tcctttcctc tctccccgtt catgccctgc actacatagc acagccggga tgcttggaac
     3421 agaggccttg gctgctccgc agtgcacagg gcttccctct ctcggggttg gcttcttccc
     3481 aggccttgca tgggccctgc ccacaagcac accctcaggc cgagggtgca gactgatgct
     3541 cttccctgat ggagaccctg agatcttccc cacccccaat catgatgtct tcagtgtggg
     3601 actggggtcc tcttggttct gcctgcagcc tgcctggctc cgcccctagt gccccctcct
     3661 caccacactg gccccaggtc tcaggagggg tgtcctgggc agggaaggtc agtgtcactg
     3721 atggtttgct gtttggaagc cattggcagg gctgccgtgc atgtggctgt gagggctgca
     3781 cagtcctgcc aaggggcttc ctccttgtca ccccgaacct tgtaatcgtg tgctggcgtg
     3841 gcagccctgg ctaagttaat ccccaccgct ttcagtggta gaaagaattc cctgagtggg
     3901 ccaggctggt gccctcctcc taccctggct tttctgagtg agctgcctgg agccctcatc
     3961 ccctctccca ggctgggctg gccctgggcg gggccactgt gtgctggccc actgtgacct
     4021 gacccgacct tgtgcagccc ccctgccctg gtgtcctggg ttttcgtgat gatctttgct
     4081 ctgtttccag tggggtttga agcagagttc agggaaccct gcccaaggtc ctcctgttca
     4141 gacattccta tgttgaataa agtatgtttg acttccccgg a
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.