LOCUS NM_001378535 4181 bp mRNA linear PRI 07-APR-2024
DEFINITION Homo sapiens ATPase H+ transporting V0 subunit a1 (ATP6V0A1),
transcript variant 11, mRNA.
ACCESSION NM_001378535
VERSION NM_001378535.1
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 4181)
AUTHORS Yamazaki,Y., Eura,Y. and Kokame,K.
TITLE V-ATPase V0a1 promotes Weibel-Palade body biogenesis through the
regulation of membrane fission
JOURNAL Elife 10, e71526 (2021)
PUBMED 34904569
REMARK GeneRIF: V-ATPase V0a1 promotes Weibel-Palade body biogenesis
through the regulation of membrane fission.
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 4181)
AUTHORS Aoto,K., Kato,M., Akita,T., Nakashima,M., Mutoh,H., Akasaka,N.,
Tohyama,J., Nomura,Y., Hoshino,K., Ago,Y., Tanaka,R., Epstein,O.,
Ben-Haim,R., Heyman,E., Miyazaki,T., Belal,H., Takabayashi,S.,
Ohba,C., Takata,A., Mizuguchi,T., Miyatake,S., Miyake,N.,
Fukuda,A., Matsumoto,N. and Saitsu,H.
TITLE ATP6V0A1 encoding the a1-subunit of the V0 domain of vacuolar
H+-ATPases is essential for brain development in humans and mice
JOURNAL Nat Commun 12 (1), 2107 (2021)
PUBMED 33833240
REMARK GeneRIF: ATP6V0A1 encoding the a1-subunit of the V0 domain of
vacuolar H(+)-ATPases is essential for brain development in humans
and mice.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 4181)
AUTHORS Wang,L., Wu,D., Robinson,C.V., Wu,H. and Fu,T.M.
TITLE Structures of a Complete Human V-ATPase Reveal Mechanisms of Its
Assembly
JOURNAL Mol Cell 80 (3), 501-511 (2020)
PUBMED 33065002
REFERENCE 4 (bases 1 to 4181)
AUTHORS Vasanthakumar,T. and Rubinstein,J.L.
TITLE Structure and Roles of V-type ATPases
JOURNAL Trends Biochem Sci 45 (4), 295-307 (2020)
PUBMED 32001091
REMARK Review article
REFERENCE 5 (bases 1 to 4181)
AUTHORS Brisson,L., Banski,P., Sboarina,M., Dethier,C., Danhier,P.,
Fontenille,M.J., Van Hee,V.F., Vazeille,T., Tardy,M., Falces,J.,
Bouzin,C., Porporato,P.E., Frederick,R., Michiels,C., Copetti,T.
and Sonveaux,P.
TITLE Lactate Dehydrogenase B Controls Lysosome Activity and Autophagy in
Cancer
JOURNAL Cancer Cell 30 (3), 418-431 (2016)
PUBMED 27622334
REFERENCE 6 (bases 1 to 4181)
AUTHORS Finbow,M.E. and Harrison,M.A.
TITLE The vacuolar H+-ATPase: a universal proton pump of eukaryotes
JOURNAL Biochem J 324 (Pt 3) (Pt 3), 697-712 (1997)
PUBMED 9210392
REMARK Review article
REFERENCE 7 (bases 1 to 4181)
AUTHORS Stevens,T.H. and Forgac,M.
TITLE Structure, function and regulation of the vacuolar (H+)-ATPase
JOURNAL Annu Rev Cell Dev Biol 13, 779-808 (1997)
PUBMED 9442887
REMARK Review article
REFERENCE 8 (bases 1 to 4181)
AUTHORS Andresson,T., Sparkowski,J., Goldstein,D.J. and Schlegel,R.
TITLE Vacuolar H(+)-ATPase mutants transform cells and define a binding
site for the papillomavirus E5 oncoprotein
JOURNAL J Biol Chem 270 (12), 6830-6837 (1995)
PUBMED 7896830
REFERENCE 9 (bases 1 to 4181)
AUTHORS Brody,L.C., Abel,K.J., Castilla,L.H., Couch,F.J., McKinley,D.R.,
Yin,G., Ho,P.P., Merajver,S., Chandrasekharappa,S.C., Xu,J. et al.
TITLE Construction of a transcription map surrounding the BRCA1 locus of
human chromosome 17
JOURNAL Genomics 25 (1), 238-247 (1995)
PUBMED 7774924
REFERENCE 10 (bases 1 to 4181)
AUTHORS Dautry-Varsat,A.
TITLE Receptor-mediated endocytosis: the intracellular journey of
transferrin and its receptor
JOURNAL Biochimie 68 (3), 375-381 (1986)
PUBMED 2874839
REMARK Review article
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AC107993.9 and AC067852.23.
Summary: This gene encodes a component of vacuolar ATPase
(V-ATPase), a multisubunit enzyme that mediates acidification of
eukaryotic intracellular organelles. V-ATPase dependent organelle
acidification is necessary for such intracellular processes as
protein sorting, zymogen activation, receptor-mediated endocytosis,
and synaptic vesicle proton gradient generation. V-ATPase is
composed of a cytosolic V1 domain and a transmembrane V0 domain.
The V1 domain consists of three A and three B subunits, two G
subunits plus the C, D, E, F, and H subunits. The V1 domain
contains the ATP catalytic site. The V0 domain consists of five
different subunits: a, c, c', c', and d. Additional isoforms of
many of the V1 and V0 subunit proteins are encoded by multiple
genes or alternatively spliced transcript variants. This gene
encodes one of three A subunit proteins and the encoded protein is
associated with clathrin-coated vesicles. Three transcript variants
encoding different isoforms have been found for this gene.
[provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
RNAseq introns :: single sample supports all introns SAMEA2145544,
SAMEA2145743 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-86 AC107993.9 131280-131365
87-250 AC107993.9 133250-133413
251-329 AC107993.9 138831-138909
330-427 AC107993.9 140412-140509
428-556 AC107993.9 142492-142620
557-639 AC107993.9 150062-150144
640-766 AC107993.9 150865-150991
767-849 AC107993.9 153069-153151
850-943 AC107993.9 155440-155533
944-1156 AC107993.9 159557-159769
1157-1307 AC107993.9 162889-163039
1308-1447 AC107993.9 166736-166875
1448-1602 AC107993.9 167436-167590
1603-1693 AC107993.9 168028-168118
1694-1812 AC107993.9 171326-171444
1813-2029 AC107993.9 173109-173325
2030-2039 AC107993.9 173599-173608
2040-2137 AC067852.23 176724-176821 c
2138-2212 AC067852.23 175160-175234 c
2213-2320 AC067852.23 170401-170508 c
2321-2338 AC067852.23 169439-169456 c
2339-2456 AC067852.23 164050-164167 c
2457-2628 AC067852.23 163568-163739 c
2629-4181 AC067852.23 155449-157001 c
FEATURES Location/Qualifiers
source 1..4181
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="17"
/map="17q21.2"
gene 1..4181
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/note="ATPase H+ transporting V0 subunit a1"
/db_xref="GeneID:535"
/db_xref="HGNC:HGNC:865"
/db_xref="MIM:192130"
exon 1..86
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 87..250
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
CDS 134..2722
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/EC_number="7.1.2.2"
/note="isoform 11 is encoded by transcript variant 11;
clathrin-coated vesicle/synaptic vesicle proton pump 116
kDa subunit; vacuolar proton translocating ATPase 116 kDa
subunit A; H(+)-transporting two-sector ATPase, 116 kDa
accessory protein A1; V-ATPase 116 kDa subunit a1;
V-ATPase subunit a1; ATPase, H+ transporting, lysosomal
non-catalytic accessory protein 1 (110/116kD);
vacuolar-type H(+)-ATPase 115 kDa subunit; V-type proton
ATPase 116 kDa subunit a; vacuolar proton pump subunit 1;
vacuolar adenosine triphosphatase subunit Ac116; ATPase,
H+ transporting, lysosomal V0 subunit a1; V-type proton
ATPase 116 kDa subunit a1; V-ATPase 116 kDa subunit a 1;
V-type proton ATPase 116 kDa subunit a 1"
/codon_start=1
/product="V-type proton ATPase 116 kDa subunit a 1 isoform
11"
/protein_id="NP_001365464.1"
/db_xref="CCDS:CCDS92319.1"
/db_xref="GeneID:535"
/db_xref="HGNC:HGNC:865"
/db_xref="MIM:192130"
/translation="MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDV
NVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFE
KIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPSEM
GRGTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKS
VFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTE
DHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQ
FALRRGTEHSGSTVPSILNRMQTNQTPPTYNKTNKFTYGFQNIVDAYGIGTYREINPA
PYTIITFPFLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYII
LLMGVFSMYTGLIYNDCFSKSLNIFGSSWSVRPMFTYNWTEETLRGNPVLQLNPALPG
VFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPL
NIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAHTSENAPSLLIHFINMFLFSYPESG
YSMLYSGQKGIQCFLVVVALLCVPWMLLFKPLVLRRQYLRRKHLEGQPVEAPVSPNPS
QQGLEAAAAATGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDADEPSEDEVFDFGD
TMVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGL
VLFFFFTAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIR
EGKFEE"
exon 251..329
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 330..427
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 428..556
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 557..639
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 640..766
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 767..849
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 850..943
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 944..1156
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 1157..1307
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 1308..1447
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 1448..1602
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 1603..1693
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 1694..1812
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 1813..2029
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 2030..2137
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 2138..2212
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 2213..2320
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 2321..2338
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 2339..2456
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 2457..2628
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
exon 2629..4181
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/inference="alignment:Splign:2.1.0"
regulatory 4156..4161
/regulatory_class="polyA_signal_sequence"
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/note="hexamer: AATAAA"
polyA_site 4181
/gene="ATP6V0A1"
/gene_synonym="a1; ATP6N1; ATP6N1A; DEE104; NEDEBA; Stv1;
Vph1; VPP1"
/note="major polyA site"
ORIGIN
1 acgtcgaagc gctgctcctg gagccgcgga gggtgcgggt ttggctgcgg tggtttctgt
61 ggcggttgct gtggcggagt ttggaggttg gagagaaatc caggtactca ctagactggt
121 accttctgcc accatggggg agcttttccg gagtgaagaa atgacactgg cccagctttt
181 tctacagtca gaggctgctt attgttgtgt cagtgaatta ggagaacttg gaaaggttca
241 gtttcgtgac ttaaatccag atgtgaatgt tttccaacgg aaatttgtga atgaagttag
301 aagatgtgaa gaaatggatc gaaagcttcg atttgttgag aaagagataa gaaaagctaa
361 cattccgatt atggacaccg gtgaaaaccc agaggttccc ttcccccggg acatgattga
421 cttagaggcc aattttgaga agattgaaaa tgaactgaag gaaatcaaca caaaccagga
481 agctctgaag agaaacttcc tggaactgac cgaattaaaa tttatacttc gcaaaactca
541 gcaatttttt gatgagatgg cggatccaga cttgttggaa gagtcctcat ccctcttgga
601 gccaagtgag atgggaagag gcactccttt aagacttggc ttcgtggctg gtgtcattaa
661 ccgggagcgc atccctactt ttgagcgcat gctttggcgg gtatgccggg gaaatgtgtt
721 cctgcgacag gctgaaatcg agaaccccct ggaggatcct gtgactggcg actacgtgca
781 caagtctgtg tttatcattt tcttccaagg cgatcagctg aaaaacagag tcaagaaaat
841 ctgtgaaggg ttccgagcct cactctatcc ctgtcctgag acaccacagg agaggaagga
901 aatggcttct ggagtgaata ccaggattga tgatctccaa atggttctga atcaaacgga
961 ggatcaccgc cagagggttc tgcaggcagc tgctaagaac atccgtgtct ggttcatcaa
1021 agtgcggaag atgaaggcca tctatcacac cctgaacctg tgcaacatag atgtgactca
1081 gaaatgcttg attgcagagg tctggtgccc tgtcaccgac cttgactcca tccagtttgc
1141 actcagaagg ggcacggaac acagtggttc cactgtacct tccattttga acaggatgca
1201 gacaaaccag actcccccaa cctataacaa aaccaacaag tttacctatg gctttcagaa
1261 catagtagat gcttatggaa ttggaactta ccgagagata aatccagctc cgtatactat
1321 tatcacgttc ccttttctat ttgctgtgat gtttggagac ttcggtcatg gcattttaat
1381 gacccttttt gctgtgtgga tggtactgag ggagagccgg atcctttccc agaagaatga
1441 gaatgagatg tttagcactg tgttcagtgg tcgatacatt attttattga tgggtgtgtt
1501 ctccatgtac actggcctca tctacaatga ttgcttttcc aagtctctta atatctttgg
1561 gtcatcctgg agtgtacggc cgatgtttac ttataattgg actgaagaga cgcttcgggg
1621 gaaccctgtt ctacagctga acccagccct ccctggagtg tttggtggac catacccttt
1681 tggcattgat ccaatttgga acattgctac caataaactg acgttcttga actcctttaa
1741 gatgaagatg tctgttatcc ttggtatcat ccatatgctg tttggagtca gcctgagtct
1801 gttcaaccat atctatttca agaagcccct gaatatctac tttggattta ttcctgaaat
1861 aatcttcatg acctctttgt ttggctattt ggttatcctt attttttaca agtggacggc
1921 ctatgatgct catacctctg agaatgcacc aagccttctg atccatttca taaacatgtt
1981 cctcttttcc tacccagagt ctggttattc aatgttgtat tctggacaga aaggaattca
2041 gtgtttcctg gtagtggttg cactactgtg tgtaccttgg atgctgctgt ttaaaccatt
2101 ggtccttcgc cgtcagtatt tgaggagaaa gcatttggaa gggcaacctg tggaggcccc
2161 agtcagccca aacccgagcc aacagggact agaggcagca gcggctgcaa caggaactct
2221 caactttggt gggatcaggg tgggcaacgg accgacagag gaggatgctg agattattca
2281 gcatgaccag ctctccaccc actcagagga cgcagacgag ccttccgagg acgaagtgtt
2341 tgactttggg gacaccatgg tccaccaggc catccacacc atcgagtact gcctgggctg
2401 catctccaac actgcctcct acttgcggct ctgggccctc agcctcgctc atgcgcagct
2461 gtctgaggtg ctttggacca tggtgatcca catcggcctg agcgtgaaga gcttggcggg
2521 aggtttggtg ctgttcttct tcttcactgc ctttgccacc ctgaccgtgg ccatcctcct
2581 gatcatggag ggcctctcgg cctttctcca cgcactgcgc ttacactggg ttgagttcca
2641 gaataaattc tacagcggga ccggtttcaa gttcttaccc ttctccttcg agcatattcg
2701 ggaagggaag tttgaagagt gagtccctgt gagggccgtg tgccccatgc taccctcccc
2761 gcctccctcc acagtgatca gctgtgcctc tctgcctgtt ggttgtgatc tgtgggcacc
2821 agctcattcg tgtcaccctg tctgtgagtc atttagatag aatagtcctc cttgggtctc
2881 ccaccacccc tagctttgtg tgtagtgtag tgattttctg gctgtcactc atactcactg
2941 ggcaccagcc ttgccctctt agcctccatc catccagaca gcccttccca cctcctggtg
3001 gtgagccagt ctgcattccc acgccatccc aaagcccttt catcttcccc gtgcattgta
3061 gatggaagga gcacccatgc cattcacatc tagactttga gttccctgca tctgccaccg
3121 tagtttctag caggagtagt ggggggagta atacagattc ttccctagaa ggggacactg
3181 gtaacatgtc ccactcttgg attagcaggg gtgggtccag gaagatgata tttgcgtctt
3241 ttgcccaccc ccctggcatt cagctggacc caactaggcc atcatgagtg gcttctccct
3301 gtcatcccca ggggtcatag gatatctaca ccgcctttct gaccccaccc tgcactccca
3361 tcctttcctc tctccccgtt catgccctgc actacatagc acagccggga tgcttggaac
3421 agaggccttg gctgctccgc agtgcacagg gcttccctct ctcggggttg gcttcttccc
3481 aggccttgca tgggccctgc ccacaagcac accctcaggc cgagggtgca gactgatgct
3541 cttccctgat ggagaccctg agatcttccc cacccccaat catgatgtct tcagtgtggg
3601 actggggtcc tcttggttct gcctgcagcc tgcctggctc cgcccctagt gccccctcct
3661 caccacactg gccccaggtc tcaggagggg tgtcctgggc agggaaggtc agtgtcactg
3721 atggtttgct gtttggaagc cattggcagg gctgccgtgc atgtggctgt gagggctgca
3781 cagtcctgcc aaggggcttc ctccttgtca ccccgaacct tgtaatcgtg tgctggcgtg
3841 gcagccctgg ctaagttaat ccccaccgct ttcagtggta gaaagaattc cctgagtggg
3901 ccaggctggt gccctcctcc taccctggct tttctgagtg agctgcctgg agccctcatc
3961 ccctctccca ggctgggctg gccctgggcg gggccactgt gtgctggccc actgtgacct
4021 gacccgacct tgtgcagccc ccctgccctg gtgtcctggg ttttcgtgat gatctttgct
4081 ctgtttccag tggggtttga agcagagttc agggaaccct gcccaaggtc ctcctgttca
4141 gacattccta tgttgaataa agtatgtttg acttccccgg a
//