U.S. flag

An official website of the United States government

Homo sapiens leukocyte immunoglobulin like receptor B4 (LILRB4), transcript variant 8, mRNA

NCBI Reference Sequence: NM_001394935.1

FASTA Graphics 

LOCUS       NM_001394935              83 bp    mRNA    linear   PRI 20-AUG-2024
DEFINITION  Homo sapiens leukocyte immunoglobulin like receptor B4 (LILRB4),
            transcript variant 8, mRNA.
ACCESSION   NM_001394935 REGION: 1..83
VERSION     NM_001394935.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 83)
  AUTHORS   Xie,L., Chen,C., Zhang,T., Yang,W., Zheng,D., Cao,L., Yuan,J.,
            Xu,Y., Zhang,Y., Liu,L., Liang,A., Yu,Z. and Zheng,J.
  TITLE     LILRB4 regulates multiple myeloma development through STAT3-PFKFB1
            pathway
  JOURNAL   Cell Death Dis 15 (7), 515 (2024)
   PUBMED   39025844
  REMARK    GeneRIF: LILRB4 regulates multiple myeloma development through
            STAT3-PFKFB1 pathway.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 83)
  AUTHORS   Wang,H., Wang,L., Luan,H., Xiao,J., Zhao,Z., Yu,P., Deng,M.,
            Liu,Y., Ji,S., Ma,J., Zhou,Y., Zhang,J., Meng,X., Zhang,J.,
            Zhao,X., Li,C., Li,F., Wang,D., Wei,S., Hui,L., Nie,S., Jin,C.,
            An,Z., Zhang,N., Wang,Y., Zhang,C.C. and Li,Z.
  TITLE     LILRB4 on multiple myeloma cells promotes bone lesion by
            p-SHP2/NF-kappaB/RELT signal pathway
  JOURNAL   J Exp Clin Cancer Res 43 (1), 183 (2024)
   PUBMED   38951916
  REMARK    GeneRIF: LILRB4 on multiple myeloma cells promotes bone lesion by
            p-SHP2/NF-kappaB/RELT signal pathway.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 83)
  AUTHORS   Xiong,J., Wang,L., Xiong,X. and Deng,Y.
  TITLE     Downregulation of LILRB4 Promotes Human Aortic Smooth Muscle Cell
            Contractile Phenotypic Switch and Apoptosis in Aortic Dissection
  JOURNAL   Cardiovasc Toxicol 24 (3), 225-239 (2024)
   PUBMED   38324114
  REMARK    GeneRIF: Downregulation of LILRB4 Promotes Human Aortic Smooth
            Muscle Cell Contractile Phenotypic Switch and Apoptosis in Aortic
            Dissection.
REFERENCE   4  (bases 1 to 83)
  AUTHORS   Xiang,Z., Yin,X., Wei,L., Peng,M., Zhu,Q., Lu,X., Guo,J., Zhang,J.,
            Li,X. and Zou,Y.
  TITLE     LILRB4 Checkpoint for Immunotherapy: Structure, Mechanism and
            Disease Targets
  JOURNAL   Biomolecules 14 (2), 187 (2024)
   PUBMED   38397424
  REMARK    GeneRIF: LILRB4 Checkpoint for Immunotherapy: Structure, Mechanism
            and Disease Targets.
            Review article
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 83)
  AUTHORS   Li,Y., Guo,J., Zhang,H., Li,Z., Ren,Y., Jiang,Y., Liu,X. and Hu,X.
  TITLE     LILRB4 regulates the function of decidual MDSCs via the SHP-2/STAT6
            pathway during Toxoplasma gondii infection
  JOURNAL   Parasit Vectors 16 (1), 237 (2023)
   PUBMED   37461040
  REMARK    GeneRIF: LILRB4 regulates the function of decidual MDSCs via the
            SHP-2/STAT6 pathway during Toxoplasma gondii infection.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 83)
  AUTHORS   Jones,D.C., Roghanian,A., Brown,D.P., Chang,C., Allen,R.L.,
            Trowsdale,J. and Young,N.T.
  TITLE     Alternative mRNA splicing creates transcripts encoding soluble
            proteins from most LILR genes
  JOURNAL   Eur J Immunol 39 (11), 3195-3206 (2009)
   PUBMED   19658091
REFERENCE   7  (bases 1 to 83)
  AUTHORS   Borges,L., Hsu,M.L., Fanger,N., Kubin,M. and Cosman,D.
  TITLE     A family of human lymphoid and myeloid Ig-like receptors, some of
            which bind to MHC class I molecules
  JOURNAL   J Immunol 159 (11), 5192-5196 (1997)
   PUBMED   9548455
REFERENCE   8  (bases 1 to 83)
  AUTHORS   Arm,J.P., Nwankwo,C. and Austen,K.F.
  TITLE     Molecular identification of a novel family of human Ig superfamily
            members that possess immunoreceptor tyrosine-based inhibition
            motifs and homology to the mouse gp49B1 inhibitory receptor
  JOURNAL   J Immunol 159 (5), 2342-2349 (1997)
   PUBMED   9278324
REFERENCE   9  (bases 1 to 83)
  AUTHORS   Cella,M., Dohring,C., Samaridis,J., Dessing,M., Brockhaus,M.,
            Lanzavecchia,A. and Colonna,M.
  TITLE     A novel inhibitory receptor (ILT3) expressed on monocytes,
            macrophages, and dendritic cells involved in antigen processing
  JOURNAL   J Exp Med 185 (10), 1743-1751 (1997)
   PUBMED   9151699
REFERENCE   10 (bases 1 to 83)
  AUTHORS   Samaridis,J. and Colonna,M.
  TITLE     Cloning of novel immunoglobulin superfamily receptors expressed on
            human myeloid and lymphoid cells: structural evidence for new
            stimulatory and inhibitory pathways
  JOURNAL   Eur J Immunol 27 (3), 660-665 (1997)
   PUBMED   9079806
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC243962.3.
            
            On May 11, 2021 this sequence version replaced XM_017026217.1.
            
            Summary: This gene is a member of the leukocyte immunoglobulin-like
            receptor (LIR) family, which is found in a gene cluster at
            chromosomal region 19q13.4. The encoded protein belongs to the
            subfamily B class of LIR receptors which contain two or four
            extracellular immunoglobulin domains, a transmembrane domain, and
            two to four cytoplasmic immunoreceptor tyrosine-based inhibitory
            motifs (ITIMs). The receptor is expressed on immune cells where it
            binds to MHC class I molecules on antigen-presenting cells and
            transduces a negative signal that inhibits stimulation of an immune
            response. The receptor can also function in antigen capture and
            presentation. It is thought to control inflammatory responses and
            cytotoxicity to help focus the immune response and limit
            autoreactivity. Multiple transcript variants encoding different
            isoforms have been found for this gene. [provided by RefSeq, Jul
            2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DRR138517.521797.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-83                AC243962.3         41432-41514
            84-119              AC243962.3         41979-42014
            120-404             AC243962.3         42201-42485
            405-704             AC243962.3         42633-42932
            705-755             AC243962.3         43246-43296
            756-803             AC243962.3         43580-43627
            804-920             AC243962.3         44262-44378
            921-996             AC243962.3         44687-44762
            997-1034            AC243962.3         44846-44883
            1035-1087           AC243962.3         45144-45196
            1088-1243           AC243962.3         46085-46240
            1244-2089           AC243962.3         46320-47165
FEATURES             Location/Qualifiers
     source          1..83
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.42"
     gene            1..>83
                     /gene="LILRB4"
                     /gene_synonym="B4; CD85K; ILT-3; ILT3; LIR-5; LIR5"
                     /note="leukocyte immunoglobulin like receptor B4"
                     /db_xref="GeneID:11006"
                     /db_xref="HGNC:HGNC:6608"
                     /db_xref="MIM:604821"
     exon            1..83
                     /gene="LILRB4"
                     /gene_synonym="B4; CD85K; ILT-3; ILT3; LIR-5; LIR5"
                     /inference="alignment:Splign:2.1.0"
     CDS             50..>83
                     /gene="LILRB4"
                     /gene_synonym="B4; CD85K; ILT-3; ILT3; LIR-5; LIR5"
                     /note="isoform 8 precursor is encoded by transcript
                     variant 8; leukocyte immunoglobulin-like receptor 5;
                     monocyte inhibitory receptor HM18; immunoglobulin-like
                     transcript 3; CD85 antigen-like family member K; leukocyte
                     immunoglobulin-like receptor, subfamily B (with TM and
                     ITIM domains), member 4; leucocyte Ig-like receptor B4"
                     /codon_start=1
                     /product="leukocyte immunoglobulin-like receptor subfamily
                     B member 4 isoform 8 precursor"
                     /protein_id="NP_001381864.1"
                     /db_xref="GeneID:11006"
                     /db_xref="HGNC:HGNC:6608"
                     /db_xref="MIM:604821"
                     /translation="MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNS
                     VTIWCQGTLEAREYRLDKEESPAPWDRQNPLEPKNKARFSIPSMTEDYAGRYRCYYRS
                     PVGWSQPSDPLELVMTGAYSKPTLSALPSPLVTSGKSVTLLCQSRSPMDTFLLIKERA
                     AHPLLHLRSEHGAQQHQAEFPMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVS
                     GSLEGPRPSPTRSVSTAGPEDQPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLF
                     LLLQHWRQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKN
                     TQPEDGVEMDTRSPHDEDPQAVTYAKVKHSRPRREMASPPSPLSGEFLDTKDRQAEED
                     RQMDTEAAASEAPQDVTYARLHSFTLRQKATEPPPSQEGASPAEPSVYATLAIH"
     sig_peptide     50..>83
                     /gene="LILRB4"
                     /gene_synonym="B4; CD85K; ILT-3; ILT3; LIR-5; LIR5"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
ORIGIN      
        1 actgaggact catccatctg cacagctggg gcccctggga ggagacgcca tgatccccac
       61 cttcacggct ctgctctgcc tcg
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown



Customize view

Reference sequence information

  • RefSeq alternative splicing
    See 83 reference mRNA sequence splice variants for the LILRB4 gene.
  • RefSeq protein product
    See the reference protein sequence for leukocyte immunoglobulin-like receptor subfamily B member 4 isoform 8 precursor (NP_001381864.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.