LOCUS NM_001394935 83 bp mRNA linear PRI 20-AUG-2024
DEFINITION Homo sapiens leukocyte immunoglobulin like receptor B4 (LILRB4),
transcript variant 8, mRNA.
ACCESSION NM_001394935 REGION: 1..83
VERSION NM_001394935.1
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 83)
AUTHORS Xie,L., Chen,C., Zhang,T., Yang,W., Zheng,D., Cao,L., Yuan,J.,
Xu,Y., Zhang,Y., Liu,L., Liang,A., Yu,Z. and Zheng,J.
TITLE LILRB4 regulates multiple myeloma development through STAT3-PFKFB1
pathway
JOURNAL Cell Death Dis 15 (7), 515 (2024)
PUBMED 39025844
REMARK GeneRIF: LILRB4 regulates multiple myeloma development through
STAT3-PFKFB1 pathway.
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 83)
AUTHORS Wang,H., Wang,L., Luan,H., Xiao,J., Zhao,Z., Yu,P., Deng,M.,
Liu,Y., Ji,S., Ma,J., Zhou,Y., Zhang,J., Meng,X., Zhang,J.,
Zhao,X., Li,C., Li,F., Wang,D., Wei,S., Hui,L., Nie,S., Jin,C.,
An,Z., Zhang,N., Wang,Y., Zhang,C.C. and Li,Z.
TITLE LILRB4 on multiple myeloma cells promotes bone lesion by
p-SHP2/NF-kappaB/RELT signal pathway
JOURNAL J Exp Clin Cancer Res 43 (1), 183 (2024)
PUBMED 38951916
REMARK GeneRIF: LILRB4 on multiple myeloma cells promotes bone lesion by
p-SHP2/NF-kappaB/RELT signal pathway.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 83)
AUTHORS Xiong,J., Wang,L., Xiong,X. and Deng,Y.
TITLE Downregulation of LILRB4 Promotes Human Aortic Smooth Muscle Cell
Contractile Phenotypic Switch and Apoptosis in Aortic Dissection
JOURNAL Cardiovasc Toxicol 24 (3), 225-239 (2024)
PUBMED 38324114
REMARK GeneRIF: Downregulation of LILRB4 Promotes Human Aortic Smooth
Muscle Cell Contractile Phenotypic Switch and Apoptosis in Aortic
Dissection.
REFERENCE 4 (bases 1 to 83)
AUTHORS Xiang,Z., Yin,X., Wei,L., Peng,M., Zhu,Q., Lu,X., Guo,J., Zhang,J.,
Li,X. and Zou,Y.
TITLE LILRB4 Checkpoint for Immunotherapy: Structure, Mechanism and
Disease Targets
JOURNAL Biomolecules 14 (2), 187 (2024)
PUBMED 38397424
REMARK GeneRIF: LILRB4 Checkpoint for Immunotherapy: Structure, Mechanism
and Disease Targets.
Review article
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 83)
AUTHORS Li,Y., Guo,J., Zhang,H., Li,Z., Ren,Y., Jiang,Y., Liu,X. and Hu,X.
TITLE LILRB4 regulates the function of decidual MDSCs via the SHP-2/STAT6
pathway during Toxoplasma gondii infection
JOURNAL Parasit Vectors 16 (1), 237 (2023)
PUBMED 37461040
REMARK GeneRIF: LILRB4 regulates the function of decidual MDSCs via the
SHP-2/STAT6 pathway during Toxoplasma gondii infection.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 83)
AUTHORS Jones,D.C., Roghanian,A., Brown,D.P., Chang,C., Allen,R.L.,
Trowsdale,J. and Young,N.T.
TITLE Alternative mRNA splicing creates transcripts encoding soluble
proteins from most LILR genes
JOURNAL Eur J Immunol 39 (11), 3195-3206 (2009)
PUBMED 19658091
REFERENCE 7 (bases 1 to 83)
AUTHORS Borges,L., Hsu,M.L., Fanger,N., Kubin,M. and Cosman,D.
TITLE A family of human lymphoid and myeloid Ig-like receptors, some of
which bind to MHC class I molecules
JOURNAL J Immunol 159 (11), 5192-5196 (1997)
PUBMED 9548455
REFERENCE 8 (bases 1 to 83)
AUTHORS Arm,J.P., Nwankwo,C. and Austen,K.F.
TITLE Molecular identification of a novel family of human Ig superfamily
members that possess immunoreceptor tyrosine-based inhibition
motifs and homology to the mouse gp49B1 inhibitory receptor
JOURNAL J Immunol 159 (5), 2342-2349 (1997)
PUBMED 9278324
REFERENCE 9 (bases 1 to 83)
AUTHORS Cella,M., Dohring,C., Samaridis,J., Dessing,M., Brockhaus,M.,
Lanzavecchia,A. and Colonna,M.
TITLE A novel inhibitory receptor (ILT3) expressed on monocytes,
macrophages, and dendritic cells involved in antigen processing
JOURNAL J Exp Med 185 (10), 1743-1751 (1997)
PUBMED 9151699
REFERENCE 10 (bases 1 to 83)
AUTHORS Samaridis,J. and Colonna,M.
TITLE Cloning of novel immunoglobulin superfamily receptors expressed on
human myeloid and lymphoid cells: structural evidence for new
stimulatory and inhibitory pathways
JOURNAL Eur J Immunol 27 (3), 660-665 (1997)
PUBMED 9079806
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AC243962.3.
On May 11, 2021 this sequence version replaced XM_017026217.1.
Summary: This gene is a member of the leukocyte immunoglobulin-like
receptor (LIR) family, which is found in a gene cluster at
chromosomal region 19q13.4. The encoded protein belongs to the
subfamily B class of LIR receptors which contain two or four
extracellular immunoglobulin domains, a transmembrane domain, and
two to four cytoplasmic immunoreceptor tyrosine-based inhibitory
motifs (ITIMs). The receptor is expressed on immune cells where it
binds to MHC class I molecules on antigen-presenting cells and
transduces a negative signal that inhibits stimulation of an immune
response. The receptor can also function in antigen capture and
presentation. It is thought to control inflammatory responses and
cytotoxicity to help focus the immune response and limit
autoreactivity. Multiple transcript variants encoding different
isoforms have been found for this gene. [provided by RefSeq, Jul
2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: DRR138517.521797.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA1965299, SAMEA1966682
[ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-83 AC243962.3 41432-41514
84-119 AC243962.3 41979-42014
120-404 AC243962.3 42201-42485
405-704 AC243962.3 42633-42932
705-755 AC243962.3 43246-43296
756-803 AC243962.3 43580-43627
804-920 AC243962.3 44262-44378
921-996 AC243962.3 44687-44762
997-1034 AC243962.3 44846-44883
1035-1087 AC243962.3 45144-45196
1088-1243 AC243962.3 46085-46240
1244-2089 AC243962.3 46320-47165
FEATURES Location/Qualifiers
source 1..83
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.42"
gene 1..>83
/gene="LILRB4"
/gene_synonym="B4; CD85K; ILT-3; ILT3; LIR-5; LIR5"
/note="leukocyte immunoglobulin like receptor B4"
/db_xref="GeneID:11006"
/db_xref="HGNC:HGNC:6608"
/db_xref="MIM:604821"
exon 1..83
/gene="LILRB4"
/gene_synonym="B4; CD85K; ILT-3; ILT3; LIR-5; LIR5"
/inference="alignment:Splign:2.1.0"
CDS 50..>83
/gene="LILRB4"
/gene_synonym="B4; CD85K; ILT-3; ILT3; LIR-5; LIR5"
/note="isoform 8 precursor is encoded by transcript
variant 8; leukocyte immunoglobulin-like receptor 5;
monocyte inhibitory receptor HM18; immunoglobulin-like
transcript 3; CD85 antigen-like family member K; leukocyte
immunoglobulin-like receptor, subfamily B (with TM and
ITIM domains), member 4; leucocyte Ig-like receptor B4"
/codon_start=1
/product="leukocyte immunoglobulin-like receptor subfamily
B member 4 isoform 8 precursor"
/protein_id="NP_001381864.1"
/db_xref="GeneID:11006"
/db_xref="HGNC:HGNC:6608"
/db_xref="MIM:604821"
/translation="MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNS
VTIWCQGTLEAREYRLDKEESPAPWDRQNPLEPKNKARFSIPSMTEDYAGRYRCYYRS
PVGWSQPSDPLELVMTGAYSKPTLSALPSPLVTSGKSVTLLCQSRSPMDTFLLIKERA
AHPLLHLRSEHGAQQHQAEFPMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVS
GSLEGPRPSPTRSVSTAGPEDQPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLF
LLLQHWRQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKN
TQPEDGVEMDTRSPHDEDPQAVTYAKVKHSRPRREMASPPSPLSGEFLDTKDRQAEED
RQMDTEAAASEAPQDVTYARLHSFTLRQKATEPPPSQEGASPAEPSVYATLAIH"
sig_peptide 50..>83
/gene="LILRB4"
/gene_synonym="B4; CD85K; ILT-3; ILT3; LIR-5; LIR5"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
ORIGIN
1 actgaggact catccatctg cacagctggg gcccctggga ggagacgcca tgatccccac
61 cttcacggct ctgctctgcc tcg
//