U.S. flag

An official website of the United States government

Homo sapiens cytochrome c1 (CYC1), mRNA

NCBI Reference Sequence: NM_001916.4

FASTA Graphics 

LOCUS       NM_001916               1251 bp    mRNA    linear   PRI 21-OCT-2018
DEFINITION  Homo sapiens cytochrome c1 (CYC1), mRNA.
ACCESSION   NM_001916
VERSION     NM_001916.4
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1251)
  AUTHORS   Chishiki M, Takagi K, Sato A, Miki Y, Yamamoto Y, Ebata A,
            Shibahara Y, Watanabe M, Ishida T, Sasano H and Suzuki T.
  TITLE     Cytochrome c1 in ductal carcinoma in situ of breast associated with
            proliferation and comedo necrosis
  JOURNAL   Cancer Sci. 108 (7), 1510-1519 (2017)
   PUBMED   28394473
  REMARK    GeneRIF: these results indicate that CYC1 plays important roles in
            cell proliferation and comedo necrosis through the elevated
            oxidative phosphorylation activity in human ductal carcinoma in
            situ
REFERENCE   2  (bases 1 to 1251)
  AUTHORS   Fan L, Zhu C, Qiu R, Zan P, Zheng Z, Xu T and Li G.
  TITLE     MicroRNA-661 Enhances TRAIL or STS Induced Osteosarcoma Cell
            Apoptosis by Modulating the Expression of Cytochrome c1
  JOURNAL   Cell. Physiol. Biochem. 41 (5), 1935-1946 (2017)
   PUBMED   28391262
  REMARK    GeneRIF: results indicate that miR-661 plays a tumor suppressor
            role in OS mediated by the downregulation of CYC1, suggesting a
            potential mechanism underlying cell death resistance in
            Osteosarcoma.
REFERENCE   3  (bases 1 to 1251)
  AUTHORS   Han Y, Sun S, Zhao M, Zhang Z, Gong S, Gao P, Liu J, Zhou J, Ma D,
            Gao Q and Wu P.
  TITLE     CYC1 Predicts Poor Prognosis in Patients with Breast Cancer
  JOURNAL   Dis. Markers 2016, 3528064 (2016)
   PUBMED   27239088
  REMARK    GeneRIF: CYC1 promoted tumor metastasis via suppressing activation
            of AMPK and contributed to tumor growth via facilitating production
            of ATP.
REFERENCE   4  (bases 1 to 1251)
  AUTHORS   Kadam CY and Abhang SA.
  TITLE     Apoptosis Markers in Breast Cancer Therapy
  JOURNAL   Adv Clin Chem 74, 143-193 (2016)
   PUBMED   27117663
  REMARK    GeneRIF: FASL, granzyme B, and cytochrome c blood expression
            reflects breast cancer progression and response to therapy.
            (Review)
            Review article
REFERENCE   5  (bases 1 to 1251)
  AUTHORS   Suzuki H, Hosokawa Y, Nishikimi M and Ozawa T.
  TITLE     Structural organization of the human mitochondrial cytochrome c1
            gene
  JOURNAL   J. Biol. Chem. 264 (3), 1368-1374 (1989)
   PUBMED   2536365
REFERENCE   6  (bases 1 to 1251)
  AUTHORS   Nishikimi M, Ohta S, Suzuki H, Tanaka T, Kikkawa F, Tanaka M,
            Kagawa Y and Ozawa T.
  TITLE     Nucleotide sequence of a cDNA encoding the precursor to human
            cytochrome c1
  JOURNAL   Nucleic Acids Res. 16 (8), 3577 (1988)
   PUBMED   2836796
REFERENCE   7  (bases 1 to 1251)
  AUTHORS   Nishikimi M, Suzuki H, Yamaguchi M, Matsukage A, Yoshida MC and
            Ozawa T.
  TITLE     Assignment of the human cytochrome c1 gene to chromosome 8
  JOURNAL   Biochem. Int. 16 (4), 655-660 (1988)
   PUBMED   2839188
REFERENCE   8  (bases 1 to 1251)
  AUTHORS   Nishikimi,M., Suzuki,H., Ohta,S., Sakurai,T., Shimomura,Y.,
            Tanaka,M., Kagawa,Y. and Ozawa,T.
  TITLE     Isolation of a cDNA clone for human cytochrome c1 from a lambda
            gt11 expression library
  JOURNAL   Biochem. Biophys. Res. Commun. 145 (1), 34-39 (1987)
   PUBMED   3036122
REFERENCE   9  (bases 1 to 1251)
  AUTHORS   Shimomura,Y., Nishikimi,M. and Ozawa,T.
  TITLE     Novel purification of cytochrome c1 from mitochondrial Complex III.
            Reconstitution of antimycin-insensitive electron transfer with the
            iron-sulfur protein and cytochrome c1
  JOURNAL   J. Biol. Chem. 260 (28), 15075-15080 (1985)
   PUBMED   2999105
REFERENCE   10 (bases 1 to 1251)
  AUTHORS   Smith,H.T., Ahmed,A.J. and Millett,F.
  TITLE     Electrostatic interaction of cytochrome c with cytochrome c1 and
            cytochrome oxidase
  JOURNAL   J. Biol. Chem. 256 (10), 4984-4990 (1981)
   PUBMED   6262312
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BG328536.1, AK225796.1,
            CN369438.1, AK026633.1 and BQ574597.1.
            This sequence is a reference standard in the RefSeqGene project.
            
            [WARNING] On Nov 23, 2018 this sequence was replaced by
            NM_001916.5.
            
            On Jan 1, 2014 this sequence version replaced NM_001916.3.
            
            Summary: This gene encodes a subunit of the cytochrome bc1 complex,
            which plays an important role in the mitochondrial respiratory
            chain by transferring electrons from the Rieske iron-sulfur protein
            to cytochrome c. Mutations in this gene may cause mitochondrial
            complex III deficiency, nuclear type 6. [provided by RefSeq, Dec
            2013].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1163655.182395.1,
                                           SRR1163655.685048.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: reported by MitoCarta
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-29                BG328536.1         2-30
            30-163              AK225796.1         27-160
            164-745             CN369438.1         106-687
            746-1232            AK026633.1         704-1190
            1233-1251           BQ574597.1         1-19                c
FEATURES             Location/Qualifiers
     source          1..1251
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q24.3"
     gene            1..1251
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /note="cytochrome c1"
                     /db_xref="GeneID:1537"
                     /db_xref="HGNC:HGNC:2579"
                     /db_xref="MIM:123980"
     exon            1..194
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /inference="alignment:Splign:2.1.0"
     CDS             66..1043
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /note="cytochrome c1, heme protein, mitochondrial; complex
                     III subunit 4; complex III subunit IV; cytochrome b-c1
                     complex subunit 4; ubiquinol-cytochrome-c reductase
                     complex cytochrome c1 subunit; cytochrome c-1"
                     /codon_start=1
                     /product="cytochrome c1, heme protein, mitochondrial
                     precursor"
                     /protein_id="NP_001907.2"
                     /db_xref="CCDS:CCDS6415.1"
                     /db_xref="GeneID:1537"
                     /db_xref="HGNC:HGNC:2579"
                     /db_xref="MIM:123980"
                     /translation="MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQA
                     VALSSKSGLSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLL
                     SSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNE
                     DGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGY
                     CEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRW
                     ASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPPK"
     transit_peptide 66..317
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Mitochondrion. {ECO:0000244|PubMed:25944712};
                     propagated from UniProtKB/Swiss-Prot (P08574.3)"
     mat_peptide     318..1040
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /product="Cytochrome c1, heme protein, mitochondrial"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P08574.3)"
     misc_feature    609..611
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000244|PubMed:23186163};
                     propagated from UniProtKB/Swiss-Prot (P08574.3); other
                     site"
     misc_feature    939..983
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P08574.3);
                     transmembrane region"
     exon            195..391
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /inference="alignment:Splign:2.1.0"
     exon            392..518
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /inference="alignment:Splign:2.1.0"
     exon            519..676
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /inference="alignment:Splign:2.1.0"
     exon            677..837
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /inference="alignment:Splign:2.1.0"
     exon            838..938
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /inference="alignment:Splign:2.1.0"
     exon            939..1234
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1210..1215
                     /regulatory_class="polyA_signal_sequence"
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
     polyA_site      1234
                     /gene="CYC1"
                     /gene_synonym="MC3DN6; UQCR4"
ORIGIN      
        1 gaggttttga ctctcgtggc gccccagggg ccgacgggag tggcggccgc gcggaggagg
       61 ccaagatggc ggcagctgcg gcttcgcttc gcggggtagt gttgggcccg cggggcgcgg
      121 ggctcccggg cgcgcgtgcc cggggtctgc tgtgcagcgc gcgtcccggg cagctcccgc
      181 tacggacacc tcaggcagtg gccttgtcgt cgaagtctgg cctttcccga ggccggaaag
      241 tgatgctgtc agcgctgggc atgctggcgg cagggggtgc ggggctggcc gtggctctgc
      301 attcggctgt gagtgccagt gacctggagc tgcacccccc cagctatccg tggtctcacc
      361 gtggcctcct ctcttccttg gaccacacca gcatccggag gggtttccag gtatataagc
      421 aggtgtgcgc ctcctgccac agcatggact tcgtggccta ccgccacctg gtgggcgtgt
      481 gctacacgga ggatgaagct aaggagctgg ctgcggaggt ggaggttcaa gacggcccca
      541 atgaagatgg ggagatgttc atgcggccag ggaagctgtt cgactatttc ccaaaaccat
      601 accccaacag tgaggctgct cgagctgcca acaacggagc attgccccct gacctcagct
      661 acatcgtgcg agctaggcat ggtggtgagg actacgtctt ctccctgctc acgggctact
      721 gcgagccacc caccggggtg tcactgcggg aaggtctcta cttcaacccc tactttcctg
      781 gccaggccat tgccatggcc cctcccatct acacagatgt cttagagttt gacgatggca
      841 ccccagctac catgtcccag atagccaagg atgtgtgcac cttcctgcgc tgggcatctg
      901 agccagagca cgaccatcga aaacgcatgg ggctcaagat gttgatgatg atggctctgc
      961 tggtgcccct ggtctacacc ataaagcggc acaagtggtc agtcctgaag agtcggaagc
     1021 tggcatatcg gccgcccaag tgaccctgtc cagtgtctgc ttgccatcct gccagaacag
     1081 gccctcaagc ccaagagcca tcccaggcct gttcaggcct cagctaagcc tctcttcatc
     1141 tggaagaaga ggcaaggggg caggagacca ggctctagct ctgggccctc cttcagcccc
     1201 catcatggga ataaattaat tttctcaatg tacaaaaaaa aaaaaaaaaa a
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.