LOCUS NM_001916 1251 bp mRNA linear PRI 21-OCT-2018
DEFINITION Homo sapiens cytochrome c1 (CYC1), mRNA.
ACCESSION NM_001916
VERSION NM_001916.4
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1251)
AUTHORS Chishiki M, Takagi K, Sato A, Miki Y, Yamamoto Y, Ebata A,
Shibahara Y, Watanabe M, Ishida T, Sasano H and Suzuki T.
TITLE Cytochrome c1 in ductal carcinoma in situ of breast associated with
proliferation and comedo necrosis
JOURNAL Cancer Sci. 108 (7), 1510-1519 (2017)
PUBMED 28394473
REMARK GeneRIF: these results indicate that CYC1 plays important roles in
cell proliferation and comedo necrosis through the elevated
oxidative phosphorylation activity in human ductal carcinoma in
situ
REFERENCE 2 (bases 1 to 1251)
AUTHORS Fan L, Zhu C, Qiu R, Zan P, Zheng Z, Xu T and Li G.
TITLE MicroRNA-661 Enhances TRAIL or STS Induced Osteosarcoma Cell
Apoptosis by Modulating the Expression of Cytochrome c1
JOURNAL Cell. Physiol. Biochem. 41 (5), 1935-1946 (2017)
PUBMED 28391262
REMARK GeneRIF: results indicate that miR-661 plays a tumor suppressor
role in OS mediated by the downregulation of CYC1, suggesting a
potential mechanism underlying cell death resistance in
Osteosarcoma.
REFERENCE 3 (bases 1 to 1251)
AUTHORS Han Y, Sun S, Zhao M, Zhang Z, Gong S, Gao P, Liu J, Zhou J, Ma D,
Gao Q and Wu P.
TITLE CYC1 Predicts Poor Prognosis in Patients with Breast Cancer
JOURNAL Dis. Markers 2016, 3528064 (2016)
PUBMED 27239088
REMARK GeneRIF: CYC1 promoted tumor metastasis via suppressing activation
of AMPK and contributed to tumor growth via facilitating production
of ATP.
REFERENCE 4 (bases 1 to 1251)
AUTHORS Kadam CY and Abhang SA.
TITLE Apoptosis Markers in Breast Cancer Therapy
JOURNAL Adv Clin Chem 74, 143-193 (2016)
PUBMED 27117663
REMARK GeneRIF: FASL, granzyme B, and cytochrome c blood expression
reflects breast cancer progression and response to therapy.
(Review)
Review article
REFERENCE 5 (bases 1 to 1251)
AUTHORS Suzuki H, Hosokawa Y, Nishikimi M and Ozawa T.
TITLE Structural organization of the human mitochondrial cytochrome c1
gene
JOURNAL J. Biol. Chem. 264 (3), 1368-1374 (1989)
PUBMED 2536365
REFERENCE 6 (bases 1 to 1251)
AUTHORS Nishikimi M, Ohta S, Suzuki H, Tanaka T, Kikkawa F, Tanaka M,
Kagawa Y and Ozawa T.
TITLE Nucleotide sequence of a cDNA encoding the precursor to human
cytochrome c1
JOURNAL Nucleic Acids Res. 16 (8), 3577 (1988)
PUBMED 2836796
REFERENCE 7 (bases 1 to 1251)
AUTHORS Nishikimi M, Suzuki H, Yamaguchi M, Matsukage A, Yoshida MC and
Ozawa T.
TITLE Assignment of the human cytochrome c1 gene to chromosome 8
JOURNAL Biochem. Int. 16 (4), 655-660 (1988)
PUBMED 2839188
REFERENCE 8 (bases 1 to 1251)
AUTHORS Nishikimi,M., Suzuki,H., Ohta,S., Sakurai,T., Shimomura,Y.,
Tanaka,M., Kagawa,Y. and Ozawa,T.
TITLE Isolation of a cDNA clone for human cytochrome c1 from a lambda
gt11 expression library
JOURNAL Biochem. Biophys. Res. Commun. 145 (1), 34-39 (1987)
PUBMED 3036122
REFERENCE 9 (bases 1 to 1251)
AUTHORS Shimomura,Y., Nishikimi,M. and Ozawa,T.
TITLE Novel purification of cytochrome c1 from mitochondrial Complex III.
Reconstitution of antimycin-insensitive electron transfer with the
iron-sulfur protein and cytochrome c1
JOURNAL J. Biol. Chem. 260 (28), 15075-15080 (1985)
PUBMED 2999105
REFERENCE 10 (bases 1 to 1251)
AUTHORS Smith,H.T., Ahmed,A.J. and Millett,F.
TITLE Electrostatic interaction of cytochrome c with cytochrome c1 and
cytochrome oxidase
JOURNAL J. Biol. Chem. 256 (10), 4984-4990 (1981)
PUBMED 6262312
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BG328536.1, AK225796.1,
CN369438.1, AK026633.1 and BQ574597.1.
This sequence is a reference standard in the RefSeqGene project.
[WARNING] On Nov 23, 2018 this sequence was replaced by
NM_001916.5.
On Jan 1, 2014 this sequence version replaced NM_001916.3.
Summary: This gene encodes a subunit of the cytochrome bc1 complex,
which plays an important role in the mitochondrial respiratory
chain by transferring electrons from the Rieske iron-sulfur protein
to cytochrome c. Mutations in this gene may cause mitochondrial
complex III deficiency, nuclear type 6. [provided by RefSeq, Dec
2013].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: SRR1163655.182395.1,
SRR1163655.685048.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA1965299, SAMEA1966682
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
gene product(s) localized to mito. :: reported by MitoCarta
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-29 BG328536.1 2-30
30-163 AK225796.1 27-160
164-745 CN369438.1 106-687
746-1232 AK026633.1 704-1190
1233-1251 BQ574597.1 1-19 c
FEATURES Location/Qualifiers
source 1..1251
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="8"
/map="8q24.3"
gene 1..1251
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/note="cytochrome c1"
/db_xref="GeneID:1537"
/db_xref="HGNC:HGNC:2579"
/db_xref="MIM:123980"
exon 1..194
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/inference="alignment:Splign:2.1.0"
CDS 66..1043
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/note="cytochrome c1, heme protein, mitochondrial; complex
III subunit 4; complex III subunit IV; cytochrome b-c1
complex subunit 4; ubiquinol-cytochrome-c reductase
complex cytochrome c1 subunit; cytochrome c-1"
/codon_start=1
/product="cytochrome c1, heme protein, mitochondrial
precursor"
/protein_id="NP_001907.2"
/db_xref="CCDS:CCDS6415.1"
/db_xref="GeneID:1537"
/db_xref="HGNC:HGNC:2579"
/db_xref="MIM:123980"
/translation="MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQA
VALSSKSGLSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLL
SSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNE
DGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGY
CEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRW
ASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPPK"
transit_peptide 66..317
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/experiment="experimental evidence, no additional details
recorded"
/note="Mitochondrion. {ECO:0000244|PubMed:25944712};
propagated from UniProtKB/Swiss-Prot (P08574.3)"
mat_peptide 318..1040
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/product="Cytochrome c1, heme protein, mitochondrial"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08574.3)"
misc_feature 609..611
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine. {ECO:0000244|PubMed:23186163};
propagated from UniProtKB/Swiss-Prot (P08574.3); other
site"
misc_feature 939..983
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (P08574.3);
transmembrane region"
exon 195..391
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/inference="alignment:Splign:2.1.0"
exon 392..518
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/inference="alignment:Splign:2.1.0"
exon 519..676
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/inference="alignment:Splign:2.1.0"
exon 677..837
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/inference="alignment:Splign:2.1.0"
exon 838..938
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/inference="alignment:Splign:2.1.0"
exon 939..1234
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
/inference="alignment:Splign:2.1.0"
regulatory 1210..1215
/regulatory_class="polyA_signal_sequence"
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
polyA_site 1234
/gene="CYC1"
/gene_synonym="MC3DN6; UQCR4"
ORIGIN
1 gaggttttga ctctcgtggc gccccagggg ccgacgggag tggcggccgc gcggaggagg
61 ccaagatggc ggcagctgcg gcttcgcttc gcggggtagt gttgggcccg cggggcgcgg
121 ggctcccggg cgcgcgtgcc cggggtctgc tgtgcagcgc gcgtcccggg cagctcccgc
181 tacggacacc tcaggcagtg gccttgtcgt cgaagtctgg cctttcccga ggccggaaag
241 tgatgctgtc agcgctgggc atgctggcgg cagggggtgc ggggctggcc gtggctctgc
301 attcggctgt gagtgccagt gacctggagc tgcacccccc cagctatccg tggtctcacc
361 gtggcctcct ctcttccttg gaccacacca gcatccggag gggtttccag gtatataagc
421 aggtgtgcgc ctcctgccac agcatggact tcgtggccta ccgccacctg gtgggcgtgt
481 gctacacgga ggatgaagct aaggagctgg ctgcggaggt ggaggttcaa gacggcccca
541 atgaagatgg ggagatgttc atgcggccag ggaagctgtt cgactatttc ccaaaaccat
601 accccaacag tgaggctgct cgagctgcca acaacggagc attgccccct gacctcagct
661 acatcgtgcg agctaggcat ggtggtgagg actacgtctt ctccctgctc acgggctact
721 gcgagccacc caccggggtg tcactgcggg aaggtctcta cttcaacccc tactttcctg
781 gccaggccat tgccatggcc cctcccatct acacagatgt cttagagttt gacgatggca
841 ccccagctac catgtcccag atagccaagg atgtgtgcac cttcctgcgc tgggcatctg
901 agccagagca cgaccatcga aaacgcatgg ggctcaagat gttgatgatg atggctctgc
961 tggtgcccct ggtctacacc ataaagcggc acaagtggtc agtcctgaag agtcggaagc
1021 tggcatatcg gccgcccaag tgaccctgtc cagtgtctgc ttgccatcct gccagaacag
1081 gccctcaagc ccaagagcca tcccaggcct gttcaggcct cagctaagcc tctcttcatc
1141 tggaagaaga ggcaaggggg caggagacca ggctctagct ctgggccctc cttcagcccc
1201 catcatggga ataaattaat tttctcaatg tacaaaaaaa aaaaaaaaaa a
//