LOCUS NM_002178 947 bp mRNA linear PRI 12-NOV-2024
DEFINITION Homo sapiens insulin like growth factor binding protein 6 (IGFBP6),
mRNA.
ACCESSION NM_002178
VERSION NM_002178.3
KEYWORDS RefSeq; MANE Select.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 947)
AUTHORS Lu,H., Yu,X., Xu,Z., Deng,J., Zhang,M.J., Zhang,Y. and Sun,S.
TITLE Prognostic Value of IGFBP6 in Breast Cancer: Focus on
Glucometabolism
JOURNAL Technol Cancer Res Treat 23, 15330338241271998 (2024)
PUBMED 39275851
REMARK GeneRIF: Prognostic Value of IGFBP6 in Breast Cancer: Focus on
Glucometabolism.
REFERENCE 2 (bases 1 to 947)
AUTHORS Efimova,A.S., Antipenko,I.D., Evtushenko,E.A., Balan,P.V. and
Tonevitskaya,S.A.
TITLE Effect of IGFBP6 Knockdown on Proteins Regulating Exosome Synthesis
and Secretion in MDA-MB-231 Cell Line
JOURNAL Bull Exp Biol Med 175 (1), 157-161 (2023)
PUBMED 37336811
REMARK GeneRIF: Effect of IGFBP6 Knockdown on Proteins Regulating Exosome
Synthesis and Secretion in MDA-MB-231 Cell Line.
REFERENCE 3 (bases 1 to 947)
AUTHORS Longhitano,L., Vicario,N., Forte,S., Giallongo,C., Broggi,G.,
Caltabiano,R., Barbagallo,G.M.V., Altieri,R., Raciti,G., Di
Rosa,M., Caruso,M., Parenti,R., Liso,A., Busi,F., Lolicato,M.,
Mione,M.C., Li Volti,G. and Tibullo,D.
TITLE Lactate modulates microglia polarization via IGFBP6 expression and
remodels tumor microenvironment in glioblastoma
JOURNAL Cancer Immunol Immunother 72 (1), 1-20 (2023)
PUBMED 35654889
REMARK GeneRIF: Lactate modulates microglia polarization via IGFBP6
expression and remodels tumor microenvironment in glioblastoma.
Erratum:[Cancer Immunol Immunother. 2023 Jan;72(1):21. doi:
10.1007/s00262-022-03243-z. PMID: 35821528]
REFERENCE 4 (bases 1 to 947)
AUTHORS Wanarase,S.R., Chavan,S.V., Sharma,S. and D,S.
TITLE Evaluation of SNPs from human IGFBP6 associated with gene
expression: an in-silico study
JOURNAL J Biomol Struct Dyn 41 (23), 13937-13949 (2023)
PUBMED 36946206
REMARK GeneRIF: Evaluation of SNPs from human IGFBP6 associated with gene
expression: an in-silico study.
REFERENCE 5 (bases 1 to 947)
AUTHORS Liso,A., Venuto,S., Coda,A.R.D., Giallongo,C., Palumbo,G.A. and
Tibullo,D.
TITLE IGFBP-6: At the Crossroads of Immunity, Tissue Repair and Fibrosis
JOURNAL Int J Mol Sci 23 (8), 4358 (2022)
PUBMED 35457175
REMARK GeneRIF: IGFBP-6: At the Crossroads of Immunity, Tissue Repair and
Fibrosis.
Review article
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 947)
AUTHORS Shimasaki,S., Gao,L., Shimonaka,M. and Ling,N.
TITLE Isolation and molecular cloning of insulin-like growth
factor-binding protein-6
JOURNAL Mol Endocrinol 5 (7), 938-948 (1991)
PUBMED 1719383
REFERENCE 7 (bases 1 to 947)
AUTHORS Kiefer,M.C., Masiarz,F.R., Bauer,D.M. and Zapf,J.
TITLE Identification and molecular cloning of two new 30-kDa insulin-like
growth factor binding proteins isolated from adult human serum
JOURNAL J Biol Chem 266 (14), 9043-9049 (1991)
PUBMED 1709161
REFERENCE 8 (bases 1 to 947)
AUTHORS Kiefer,M.C., Ioh,R.S., Bauer,D.M. and Zapf,J.
TITLE Molecular cloning of a new human insulin-like growth factor binding
protein
JOURNAL Biochem Biophys Res Commun 176 (1), 219-225 (1991)
PUBMED 1850258
REFERENCE 9 (bases 1 to 947)
AUTHORS Andress,D.L. and Birnbaum,R.S.
TITLE A novel human insulin-like growth factor binding protein secreted
by osteoblast-like cells
JOURNAL Biochem Biophys Res Commun 176 (1), 213-218 (1991)
PUBMED 1850257
REMARK Erratum:[Biochem Biophys Res Commun 1991 Jun 14;177(2):895]
REFERENCE 10 (bases 1 to 947)
AUTHORS Zapf,J., Kiefer,M., Merryweather,J., Musiarz,F., Bauer,D., Born,W.,
Fischer,J.A. and Froesch,E.R.
TITLE Isolation from adult human serum of four insulin-like growth factor
(IGF) binding proteins and molecular cloning of one of them that is
increased by IGF I administration and in extrapancreatic tumor
hypoglycemia
JOURNAL J Biol Chem 265 (25), 14892-14898 (1990)
PUBMED 1697583
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BQ925731.1 and M69054.1.
On Nov 22, 2018 this sequence version replaced NM_002178.2.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC010162.2, M62402.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA1965299, SAMEA1966682
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
MANE Ensembl match :: ENST00000301464.4/ ENSP00000301464.3
RefSeq Select criteria :: based on conservation, expression,
longest protein
##RefSeq-Attributes-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-385 BQ925731.1 224-608
386-947 M69054.1 334-895
FEATURES Location/Qualifiers
source 1..947
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="12"
/map="12q13.13"
gene 1..947
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="insulin like growth factor binding protein 6"
/db_xref="GeneID:3489"
/db_xref="HGNC:HGNC:5475"
/db_xref="MIM:146735"
exon 1..385
/gene="IGFBP6"
/gene_synonym="IBP6"
/inference="alignment:Splign:2.1.0"
CDS 52..774
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="IGF binding protein 6; IBP-6; IGFBP-6"
/codon_start=1
/product="insulin-like growth factor-binding protein 6
precursor"
/protein_id="NP_002169.1"
/db_xref="CCDS:CCDS8846.1"
/db_xref="GeneID:3489"
/db_xref="HGNC:HGNC:5475"
/db_xref="MIM:146735"
/translation="MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGC
VEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRG
RCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEM
GPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRM
GKSLPGSPDGNGSSSCPTGSSG"
sig_peptide 52..132
/gene="IGFBP6"
/gene_synonym="IBP6"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
mat_peptide 133..771
/gene="IGFBP6"
/gene_synonym="IBP6"
/product="Insulin-like growth factor-binding protein 6.
/id=PRO_0000014389"
/note="propagated from UniProtKB/Swiss-Prot (P24592.1)"
misc_feature 376..531
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="propagated from UniProtKB/Swiss-Prot (P24592.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 427..429
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="O-linked (HexNAc...) threonine.
/evidence=ECO:0000269|PubMed:19838169,
ECO:0000269|PubMed:9572875; propagated from
UniProtKB/Swiss-Prot (P24592.1); glycosylation site"
misc_feature 481..483
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="O-linked (HexNAc...) serine. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (P24592.1);
glycosylation site"
misc_feature 484..486
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="O-linked (HexNAc...) threonine.
/evidence=ECO:0000250; propagated from
UniProtKB/Swiss-Prot (P24592.1); glycosylation site"
misc_feature 487..489
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="O-linked (HexNAc...) threonine.
/evidence=ECO:0000250; propagated from
UniProtKB/Swiss-Prot (P24592.1); glycosylation site"
misc_feature 505..507
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="O-linked (HexNAc...) serine. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (P24592.1);
glycosylation site"
misc_feature 700..771
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="propagated from UniProtKB/Swiss-Prot (P24592.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
exon 386..531
/gene="IGFBP6"
/gene_synonym="IBP6"
/inference="alignment:Splign:2.1.0"
exon 532..651
/gene="IGFBP6"
/gene_synonym="IBP6"
/inference="alignment:Splign:2.1.0"
exon 652..947
/gene="IGFBP6"
/gene_synonym="IBP6"
/inference="alignment:Splign:2.1.0"
regulatory 927..932
/regulatory_class="polyA_signal_sequence"
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="hexamer: AATAAA"
polyA_site 947
/gene="IGFBP6"
/gene_synonym="IBP6"
/note="major polyA site"
ORIGIN
1 agctgcgctg cgactgctct ggaaggagag gacggggcac aaaccctgac catgaccccc
61 cacaggctgc tgccaccgct gctgctgctg ctagctctgc tgctcgctgc cagcccagga
121 ggcgccttgg cgcggtgccc aggctgcggg caaggggtgc aggcgggttg tccagggggc
181 tgcgtggagg aggaggatgg ggggtcgcca gccgagggct gcgcggaagc tgagggctgt
241 ctcaggaggg aggggcagga gtgcggggtc tacaccccta actgcgcccc aggactgcag
301 tgccatccgc ccaaggacga cgaggcgcct ttgcgggcgc tgctgctcgg ccgaggccgc
361 tgccttccgg cccgcgcgcc tgctgttgca gaggagaatc ctaaggagag taaaccccaa
421 gcaggcactg cccgcccaca ggatgtgaac cgcagagacc aacagaggaa tccaggcacc
481 tctaccacgc cctcccagcc caattctgcg ggtgtccaag acactgagat gggcccatgc
541 cgtagacatc tggactcagt gctgcagcaa ctccagactg aggtctaccg aggggctcaa
601 acactctacg tgcccaattg tgaccatcga ggcttctacc ggaagcggca gtgccgctcc
661 tcccaggggc agcgccgagg tccctgctgg tgtgtggatc ggatgggcaa gtccctgcca
721 gggtctccag atggcaatgg aagctcctcc tgccccactg ggagtagcgg ctaaagctgg
781 gggatagagg ggctgcaggg ccactggaag gaacatggag ctgtcatcac tcaacaaaaa
841 accgaggccc tcaatccacc ttcaggcccc gccccatggg cccctcaccg ctggttggaa
901 agagtgttgg tgttggctgg ggtgtcaata aagctgtgct tggggtc
//