U.S. flag

An official website of the United States government

Homo sapiens insulin like growth factor binding protein 6 (IGFBP6), mRNA

NCBI Reference Sequence: NM_002178.3

FASTA Graphics 

LOCUS       NM_002178                947 bp    mRNA    linear   PRI 12-NOV-2024
DEFINITION  Homo sapiens insulin like growth factor binding protein 6 (IGFBP6),
            mRNA.
ACCESSION   NM_002178
VERSION     NM_002178.3
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 947)
  AUTHORS   Lu,H., Yu,X., Xu,Z., Deng,J., Zhang,M.J., Zhang,Y. and Sun,S.
  TITLE     Prognostic Value of IGFBP6 in Breast Cancer: Focus on
            Glucometabolism
  JOURNAL   Technol Cancer Res Treat 23, 15330338241271998 (2024)
   PUBMED   39275851
  REMARK    GeneRIF: Prognostic Value of IGFBP6 in Breast Cancer: Focus on
            Glucometabolism.
REFERENCE   2  (bases 1 to 947)
  AUTHORS   Efimova,A.S., Antipenko,I.D., Evtushenko,E.A., Balan,P.V. and
            Tonevitskaya,S.A.
  TITLE     Effect of IGFBP6 Knockdown on Proteins Regulating Exosome Synthesis
            and Secretion in MDA-MB-231 Cell Line
  JOURNAL   Bull Exp Biol Med 175 (1), 157-161 (2023)
   PUBMED   37336811
  REMARK    GeneRIF: Effect of IGFBP6 Knockdown on Proteins Regulating Exosome
            Synthesis and Secretion in MDA-MB-231 Cell Line.
REFERENCE   3  (bases 1 to 947)
  AUTHORS   Longhitano,L., Vicario,N., Forte,S., Giallongo,C., Broggi,G.,
            Caltabiano,R., Barbagallo,G.M.V., Altieri,R., Raciti,G., Di
            Rosa,M., Caruso,M., Parenti,R., Liso,A., Busi,F., Lolicato,M.,
            Mione,M.C., Li Volti,G. and Tibullo,D.
  TITLE     Lactate modulates microglia polarization via IGFBP6 expression and
            remodels tumor microenvironment in glioblastoma
  JOURNAL   Cancer Immunol Immunother 72 (1), 1-20 (2023)
   PUBMED   35654889
  REMARK    GeneRIF: Lactate modulates microglia polarization via IGFBP6
            expression and remodels tumor microenvironment in glioblastoma.
            Erratum:[Cancer Immunol Immunother. 2023 Jan;72(1):21. doi:
            10.1007/s00262-022-03243-z. PMID: 35821528]
REFERENCE   4  (bases 1 to 947)
  AUTHORS   Wanarase,S.R., Chavan,S.V., Sharma,S. and D,S.
  TITLE     Evaluation of SNPs from human IGFBP6 associated with gene
            expression: an in-silico study
  JOURNAL   J Biomol Struct Dyn 41 (23), 13937-13949 (2023)
   PUBMED   36946206
  REMARK    GeneRIF: Evaluation of SNPs from human IGFBP6 associated with gene
            expression: an in-silico study.
REFERENCE   5  (bases 1 to 947)
  AUTHORS   Liso,A., Venuto,S., Coda,A.R.D., Giallongo,C., Palumbo,G.A. and
            Tibullo,D.
  TITLE     IGFBP-6: At the Crossroads of Immunity, Tissue Repair and Fibrosis
  JOURNAL   Int J Mol Sci 23 (8), 4358 (2022)
   PUBMED   35457175
  REMARK    GeneRIF: IGFBP-6: At the Crossroads of Immunity, Tissue Repair and
            Fibrosis.
            Review article
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 947)
  AUTHORS   Shimasaki,S., Gao,L., Shimonaka,M. and Ling,N.
  TITLE     Isolation and molecular cloning of insulin-like growth
            factor-binding protein-6
  JOURNAL   Mol Endocrinol 5 (7), 938-948 (1991)
   PUBMED   1719383
REFERENCE   7  (bases 1 to 947)
  AUTHORS   Kiefer,M.C., Masiarz,F.R., Bauer,D.M. and Zapf,J.
  TITLE     Identification and molecular cloning of two new 30-kDa insulin-like
            growth factor binding proteins isolated from adult human serum
  JOURNAL   J Biol Chem 266 (14), 9043-9049 (1991)
   PUBMED   1709161
REFERENCE   8  (bases 1 to 947)
  AUTHORS   Kiefer,M.C., Ioh,R.S., Bauer,D.M. and Zapf,J.
  TITLE     Molecular cloning of a new human insulin-like growth factor binding
            protein
  JOURNAL   Biochem Biophys Res Commun 176 (1), 219-225 (1991)
   PUBMED   1850258
REFERENCE   9  (bases 1 to 947)
  AUTHORS   Andress,D.L. and Birnbaum,R.S.
  TITLE     A novel human insulin-like growth factor binding protein secreted
            by osteoblast-like cells
  JOURNAL   Biochem Biophys Res Commun 176 (1), 213-218 (1991)
   PUBMED   1850257
  REMARK    Erratum:[Biochem Biophys Res Commun 1991 Jun 14;177(2):895]
REFERENCE   10 (bases 1 to 947)
  AUTHORS   Zapf,J., Kiefer,M., Merryweather,J., Musiarz,F., Bauer,D., Born,W.,
            Fischer,J.A. and Froesch,E.R.
  TITLE     Isolation from adult human serum of four insulin-like growth factor
            (IGF) binding proteins and molecular cloning of one of them that is
            increased by IGF I administration and in extrapancreatic tumor
            hypoglycemia
  JOURNAL   J Biol Chem 265 (25), 14892-14898 (1990)
   PUBMED   1697583
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BQ925731.1 and M69054.1.
            
            On Nov 22, 2018 this sequence version replaced NM_002178.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC010162.2, M62402.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000301464.4/ ENSP00000301464.3
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-385               BQ925731.1         224-608
            386-947             M69054.1           334-895
FEATURES             Location/Qualifiers
     source          1..947
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12q13.13"
     gene            1..947
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="insulin like growth factor binding protein 6"
                     /db_xref="GeneID:3489"
                     /db_xref="HGNC:HGNC:5475"
                     /db_xref="MIM:146735"
     exon            1..385
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /inference="alignment:Splign:2.1.0"
     CDS             52..774
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="IGF binding protein 6; IBP-6; IGFBP-6"
                     /codon_start=1
                     /product="insulin-like growth factor-binding protein 6
                     precursor"
                     /protein_id="NP_002169.1"
                     /db_xref="CCDS:CCDS8846.1"
                     /db_xref="GeneID:3489"
                     /db_xref="HGNC:HGNC:5475"
                     /db_xref="MIM:146735"
                     /translation="MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGC
                     VEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRG
                     RCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEM
                     GPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRM
                     GKSLPGSPDGNGSSSCPTGSSG"
     sig_peptide     52..132
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     mat_peptide     133..771
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /product="Insulin-like growth factor-binding protein 6.
                     /id=PRO_0000014389"
                     /note="propagated from UniProtKB/Swiss-Prot (P24592.1)"
     misc_feature    376..531
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="propagated from UniProtKB/Swiss-Prot (P24592.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    427..429
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="O-linked (HexNAc...) threonine.
                     /evidence=ECO:0000269|PubMed:19838169,
                     ECO:0000269|PubMed:9572875; propagated from
                     UniProtKB/Swiss-Prot (P24592.1); glycosylation site"
     misc_feature    481..483
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="O-linked (HexNAc...) serine. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (P24592.1);
                     glycosylation site"
     misc_feature    484..486
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="O-linked (HexNAc...) threonine.
                     /evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (P24592.1); glycosylation site"
     misc_feature    487..489
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="O-linked (HexNAc...) threonine.
                     /evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (P24592.1); glycosylation site"
     misc_feature    505..507
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="O-linked (HexNAc...) serine. /evidence=ECO:0000250;
                     propagated from UniProtKB/Swiss-Prot (P24592.1);
                     glycosylation site"
     misc_feature    700..771
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="propagated from UniProtKB/Swiss-Prot (P24592.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            386..531
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /inference="alignment:Splign:2.1.0"
     exon            532..651
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /inference="alignment:Splign:2.1.0"
     exon            652..947
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /inference="alignment:Splign:2.1.0"
     regulatory      927..932
                     /regulatory_class="polyA_signal_sequence"
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="hexamer: AATAAA"
     polyA_site      947
                     /gene="IGFBP6"
                     /gene_synonym="IBP6"
                     /note="major polyA site"
ORIGIN      
        1 agctgcgctg cgactgctct ggaaggagag gacggggcac aaaccctgac catgaccccc
       61 cacaggctgc tgccaccgct gctgctgctg ctagctctgc tgctcgctgc cagcccagga
      121 ggcgccttgg cgcggtgccc aggctgcggg caaggggtgc aggcgggttg tccagggggc
      181 tgcgtggagg aggaggatgg ggggtcgcca gccgagggct gcgcggaagc tgagggctgt
      241 ctcaggaggg aggggcagga gtgcggggtc tacaccccta actgcgcccc aggactgcag
      301 tgccatccgc ccaaggacga cgaggcgcct ttgcgggcgc tgctgctcgg ccgaggccgc
      361 tgccttccgg cccgcgcgcc tgctgttgca gaggagaatc ctaaggagag taaaccccaa
      421 gcaggcactg cccgcccaca ggatgtgaac cgcagagacc aacagaggaa tccaggcacc
      481 tctaccacgc cctcccagcc caattctgcg ggtgtccaag acactgagat gggcccatgc
      541 cgtagacatc tggactcagt gctgcagcaa ctccagactg aggtctaccg aggggctcaa
      601 acactctacg tgcccaattg tgaccatcga ggcttctacc ggaagcggca gtgccgctcc
      661 tcccaggggc agcgccgagg tccctgctgg tgtgtggatc ggatgggcaa gtccctgcca
      721 gggtctccag atggcaatgg aagctcctcc tgccccactg ggagtagcgg ctaaagctgg
      781 gggatagagg ggctgcaggg ccactggaag gaacatggag ctgtcatcac tcaacaaaaa
      841 accgaggccc tcaatccacc ttcaggcccc gccccatggg cccctcaccg ctggttggaa
      901 agagtgttgg tgttggctgg ggtgtcaata aagctgtgct tggggtc
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.