U.S. flag

An official website of the United States government

Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA

NCBI Reference Sequence: NM_002620.4

FASTA Graphics 

LOCUS       NM_002620                743 bp    mRNA    linear   PRI 04-APR-2024
DEFINITION  Homo sapiens platelet factor 4 variant 1 (PF4V1), mRNA.
ACCESSION   NM_002620
VERSION     NM_002620.4
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 743)
  AUTHORS   Brandhofer,M., Hoffmann,A., Blanchet,X., Siminkovitch,E.,
            Rohlfing,A.K., El Bounkari,O., Nestele,J.A., Bild,A., Kontos,C.,
            Hille,K., Rohde,V., Frohlich,A., Golemi,J., Gokce,O., Krammer,C.,
            Scheiermann,P., Tsilimparis,N., Sachs,N., Kempf,W.E.,
            Maegdefessel,L., Otabil,M.K., Megens,R.T.A., Ippel,H., Koenen,R.R.,
            Luo,J., Engelmann,B., Mayo,K.H., Gawaz,M., Kapurniotu,A., Weber,C.,
            von Hundelshausen,P. and Bernhagen,J.
  TITLE     Heterocomplexes between the atypical chemokine MIF and the
            CXC-motif chemokine CXCL4L1 regulate inflammation and thrombus
            formation
  JOURNAL   Cell Mol Life Sci 79 (10), 512 (2022)
   PUBMED   36094626
  REMARK    GeneRIF: Heterocomplexes between the atypical chemokine MIF and the
            CXC-motif chemokine CXCL4L1 regulate inflammation and thrombus
            formation.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 743)
  AUTHORS   Kaczor,D.M., Kramann,R., Hackeng,T.M., Schurgers,L.J. and
            Koenen,R.R.
  TITLE     Differential Effects of Platelet Factor 4 (CXCL4) and Its
            Non-Allelic Variant (CXCL4L1) on Cultured Human Vascular Smooth
            Muscle Cells
  JOURNAL   Int J Mol Sci 23 (2), 580 (2022)
   PUBMED   35054772
  REMARK    GeneRIF: Differential Effects of Platelet Factor 4 (CXCL4) and Its
            Non-Allelic Variant (CXCL4L1) on Cultured Human Vascular Smooth
            Muscle Cells.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 743)
  AUTHORS   Armbrust,T., Millis,M.P., Alvarez,M.L., Saremi,A., DiStefano,J.K.
            and Nourbakhsh,M.
  TITLE     CXCL4L1 Promoter Polymorphisms Are Associated with Improved Renal
            Function in Type 1 Diabetes
  JOURNAL   J Immunol 202 (3), 912-919 (2019)
   PUBMED   30593538
  REMARK    GeneRIF: CXCL4L1 promoter variants may protect against the
            development of renal inflammation in diabetes by increasing CXCL4L1
            expression, which in turn activates the anti-inflammatory SMAD7 and
            IkappaBalpha factors in mesangial cells.
REFERENCE   4  (bases 1 to 743)
  AUTHORS   Ruytinx,P., Proost,P. and Struyf,S.
  TITLE     CXCL4 and CXCL4L1 in cancer
  JOURNAL   Cytokine 109, 65-71 (2018)
   PUBMED   29903575
  REMARK    GeneRIF: CXCL4 and CXCL4L1 shift the angiogenic/angiostatic balance
            in favor of angiostasis. CXCL4L1 in particular was found to be a
            more potent angiostatic, anti-tumoral and anti-metastatic
            chemokine, which was verified in different in vivo models.
            Review article
REFERENCE   5  (bases 1 to 743)
  AUTHORS   von Hundelshausen,P., Agten,S.M., Eckardt,V., Blanchet,X.,
            Schmitt,M.M., Ippel,H., Neideck,C., Bidzhekov,K., Leberzammer,J.,
            Wichapong,K., Faussner,A., Drechsler,M., Grommes,J., van
            Geffen,J.P., Li,H., Ortega-Gomez,A., Megens,R.T., Naumann,R.,
            Dijkgraaf,I., Nicolaes,G.A., Doring,Y., Soehnlein,O., Lutgens,E.,
            Heemskerk,J.W., Koenen,R.R., Mayo,K.H., Hackeng,T.M. and Weber,C.
  TITLE     Chemokine interactome mapping enables tailored intervention in
            acute and chronic inflammation
  JOURNAL   Sci Transl Med 9 (384) (2017)
   PUBMED   28381538
REFERENCE   6  (bases 1 to 743)
  AUTHORS   Hillian,A.D., Londono,D., Dunn,J.M., Goddard,K.A., Pace,R.G.,
            Knowles,M.R. and Drumm,M.L.
  CONSRTM   CF Gene Modifier Study Group
  TITLE     Modulation of cystic fibrosis lung disease by variants in
            interleukin-8
  JOURNAL   Genes Immun 9 (6), 501-508 (2008)
   PUBMED   18563170
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   7  (bases 1 to 743)
  AUTHORS   Struyf,S., Burdick,M.D., Proost,P., Van Damme,J. and Strieter,R.M.
  TITLE     Platelets release CXCL4L1, a nonallelic variant of the chemokine
            platelet factor-4/CXCL4 and potent inhibitor of angiogenesis
  JOURNAL   Circ Res 95 (9), 855-857 (2004)
   PUBMED   15459074
REFERENCE   8  (bases 1 to 743)
  AUTHORS   Gevaert,K., Goethals,M., Martens,L., Van Damme,J., Staes,A.,
            Thomas,G.R. and Vandekerckhove,J.
  TITLE     Exploring proteomes and analyzing protein processing by mass
            spectrometric identification of sorted N-terminal peptides
  JOURNAL   Nat Biotechnol 21 (5), 566-569 (2003)
   PUBMED   12665801
REFERENCE   9  (bases 1 to 743)
  AUTHORS   Eisman,R., Surrey,S., Ramachandran,B., Schwartz,E. and Poncz,M.
  TITLE     Structural and functional comparison of the genes for human
            platelet factor 4 and PF4alt
  JOURNAL   Blood 76 (2), 336-344 (1990)
   PUBMED   1695112
REFERENCE   10 (bases 1 to 743)
  AUTHORS   Green,C.J., Charles,R.S., Edwards,B.F. and Johnson,P.H.
  TITLE     Identification and characterization of PF4varl, a human gene
            variant of platelet factor 4
  JOURNAL   Mol Cell Biol 9 (4), 1445-1451 (1989)
   PUBMED   2725510
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC092438.5 and BC130653.1.
            
            On Nov 22, 2018 this sequence version replaced NM_002620.3.
            
            Summary: The protein encoded by this gene is a chemokine that is
            highly similar to platelet factor 4. The encoded protein displays a
            strong antiangiogenic function and is regulated by chemokine (C-X-C
            motif) receptor 3. This protein also impairs tumor growth and can
            protect against blood-retinal barrier breakdown in diabetes
            patients. [provided by RefSeq, Nov 2015].
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR5189655.25447.1, ERR279829.555.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2144333, SAMEA2144335
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000226524.4/ ENSP00000226524.3
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-39                AC092438.5         4928-4966
            40-411              BC130653.1         1-372
            412-743             AC092438.5         5784-6115
FEATURES             Location/Qualifiers
     source          1..743
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="4"
                     /map="4q13.3"
     gene            1..743
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /note="platelet factor 4 variant 1"
                     /db_xref="GeneID:5197"
                     /db_xref="HGNC:HGNC:8862"
                     /db_xref="MIM:173461"
     exon            1..167
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /inference="alignment:Splign:2.1.0"
     CDS             68..382
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /note="platelet factor 4, variant 1 (PF4-like); PF4alt;
                     PF4var1; C-X-C motif chemokine 4"
                     /codon_start=1
                     /product="platelet factor 4 variant precursor"
                     /protein_id="NP_002611.1"
                     /db_xref="CCDS:CCDS3561.1"
                     /db_xref="GeneID:5197"
                     /db_xref="HGNC:HGNC:8862"
                     /db_xref="MIM:173461"
                     /translation="MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQC
                     LCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHL
                     ES"
     sig_peptide     68..157
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /note="/evidence=ECO:0000269|PubMed:15459074; propagated
                     from UniProtKB/Swiss-Prot (P10720.1)"
     mat_peptide     158..379
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /product="Platelet factor 4 variant. /id=PRO_0000005071"
                     /note="propagated from UniProtKB/Swiss-Prot (P10720.1)"
     mat_peptide     167..379
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /product="Platelet factor 4 variant(4-74).
                     /id=PRO_0000005072"
                     /note="propagated from UniProtKB/Swiss-Prot (P10720.1)"
     mat_peptide     170..379
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /product="Platelet factor 4 variant(5-74).
                     /id=PRO_0000005073"
                     /note="propagated from UniProtKB/Swiss-Prot (P10720.1)"
     mat_peptide     173..379
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /product="Platelet factor 4 variant(6-74).
                     /id=PRO_0000005074"
                     /note="propagated from UniProtKB/Swiss-Prot (P10720.1)"
     exon            168..294
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /inference="alignment:Splign:2.1.0"
     exon            295..743
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /inference="alignment:Splign:2.1.0"
     regulatory      470..475
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /note="hexamer: AATAAA"
     polyA_site      495
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
     regulatory      716..721
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /note="hexamer: AATAAA"
     polyA_site      743
                     /gene="PF4V1"
                     /gene_synonym="CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1"
                     /note="major polyA site"
ORIGIN      
        1 actgcctgca gaaccccagc ccgactttcc ctgcgcactg ggatcctgct ggaacctcag
       61 ctgcaacatg agctccgcag ccaggtcccg cctcacccgc gccacccgcc aggagatgct
      121 gttcttggcg ttgctgctcc tgccagttgt ggtcgccttc gccagagctg aagctgaaga
      181 agatggggac ctgcagtgcc tgtgtgtgaa gaccacctcc caggtccgtc ccaggcacat
      241 caccagcctg gaggtgatca aggccggacc ccactgcccc actgcccaac tcatagccac
      301 gctgaagaat gggaggaaaa tttgcttgga tctgcaagcc ctgctgtaca agaaaatcat
      361 taaggaacat ttggagagtt agctactagc tgcctaagtg tgcactttca atctaactgt
      421 gaaagaatct tctgatgttt gtattatcct tcttatatta tattaacgaa ataaatcaag
      481 ttgtggtata gtcaatctat ttcttaataa tactgcaaaa ataatgctga cacatcacaa
      541 tttcatattt taaaatttcc agaattttaa gcaaaaagca ttatgaagga aggcttggtt
      601 taataaagac tgattttgtt cagtgttata tgttagctga tacatatttg ttcatttatg
      661 tgattgcagt actttatagc tacatattta ccttgaatgt tacaattagc ttgccaataa
      721 atattagtag ctcttaagca tta
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for platelet factor 4 variant precursor (NP_002611.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.