U.S. flag

An official website of the United States government

Homo sapiens fibroblast growth factor 3 (FGF3), mRNA

NCBI Reference Sequence: NM_005247.4

FASTA Graphics 

LOCUS       NM_005247               1540 bp    mRNA    linear   PRI 11-OCT-2024
DEFINITION  Homo sapiens fibroblast growth factor 3 (FGF3), mRNA.
ACCESSION   NM_005247
VERSION     NM_005247.4
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1540)
  AUTHORS   Hutchings,C. and Sela-Donenfeld,D.
  TITLE     Primer on FGF3
  JOURNAL   Differentiation 139, 100730 (2024)
   PUBMED   37741710
  REMARK    GeneRIF: Primer on FGF3.
            Review article
REFERENCE   2  (bases 1 to 1540)
  AUTHORS   Mao,P., Cohen,O., Kowalski,K.J., Kusiel,J.G., Buendia-Buendia,J.E.,
            Cuoco,M.S., Exman,P., Wander,S.A., Waks,A.G., Nayar,U., Chung,J.,
            Freeman,S., Rozenblatt-Rosen,O., Miller,V.A., Piccioni,F.,
            Root,D.E., Regev,A., Winer,E.P., Lin,N.U. and Wagle,N.
  TITLE     Acquired FGFR and FGF Alterations Confer Resistance to Estrogen
            Receptor (ER) Targeted Therapy in ER+ Metastatic Breast Cancer
  JOURNAL   Clin Cancer Res 26 (22), 5974-5989 (2020)
   PUBMED   32723837
  REMARK    GeneRIF: Acquired FGFR and FGF Alterations Confer Resistance to
            Estrogen Receptor (ER) Targeted Therapy in ER(+) Metastatic Breast
            Cancer.
REFERENCE   3  (bases 1 to 1540)
  AUTHORS   Carpio Horta,K., Weiss,S.G., Miranda,K., Sebastiani,A.M.,
            Costa,D.J.D., Matsumoto,M.A.N., Maranon-Vasquez,G.A., Vieira,A.R.,
            Scariot,R. and Kuchler,E.C.
  TITLE     Polymorphisms in FGF3, FGF10, and FGF13 May Contribute to the
            Presence of Temporomandibular Disorders in Patients Who Required
            Orthognathic Surgery
  JOURNAL   J Craniofac Surg 30 (7), 2082-2084 (2019)
   PUBMED   31574782
  REMARK    GeneRIF: Genetic polymorphisms in FGF3, FGF10, and FGF13 genes were
            associated with temporomandibular disorders in a population with
            dentofacial deformities
REFERENCE   4  (bases 1 to 1540)
  AUTHORS   Al Yassin,A., D'Arco,F., Morin,M., Pagarkar,W.,
            Harrop-Griffiths,K., Shaida,A., Fernandez,E., Cullup,T.,
            De-Souza,B., Moreno-Pelayo,M.A. and Bitner-Glindzicz,M.
  TITLE     Three New Mutations and Mild, Asymmetrical Phenotype in the Highly
            Distinctive LAMM Syndrome: A Report of Eight Further Cases
  JOURNAL   Genes (Basel) 10 (7), 529 (2019)
   PUBMED   31336982
  REMARK    GeneRIF: eight cases of LAMM syndrome with three novel FGF3
            mutations
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1540)
  AUTHORS   Liu,L.M.
  TITLE     Inhibitory effects of int-2 gene on the invasion and metastasis of
            oral cancer cells
  JOURNAL   Eur Rev Med Pharmacol Sci 21 (24), 5677-5682 (2017)
   PUBMED   29272002
  REMARK    GeneRIF: Upregulation of int-2 expression can significantly inhibit
            the invasion and metastasis of BcaCD885 cells
REFERENCE   6  (bases 1 to 1540)
  AUTHORS   Mansour,S.L., Goddard,J.M. and Capecchi,M.R.
  TITLE     Mice homozygous for a targeted disruption of the proto-oncogene
            int-2 have developmental defects in the tail and inner ear
  JOURNAL   Development 117 (1), 13-28 (1993)
   PUBMED   8223243
REFERENCE   7  (bases 1 to 1540)
  AUTHORS   Ordonez,J. and Tekin,M.
  TITLE     Congenital Deafness with Labyrinthine Aplasia, Microtia, and
            Microdontia
  JOURNAL   (in) Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE and
            Amemiya A (Eds.);
            GENEREVIEWS(R);
            (1993)
   PUBMED   22993869
REFERENCE   8  (bases 1 to 1540)
  AUTHORS   Represa,J., Leon,Y., Miner,C. and Giraldez,F.
  TITLE     The int-2 proto-oncogene is responsible for induction of the inner
            ear
  JOURNAL   Nature 353 (6344), 561-563 (1991)
   PUBMED   1922362
REFERENCE   9  (bases 1 to 1540)
  AUTHORS   Brookes,S., Smith,R., Casey,G., Dickson,C. and Peters,G.
  TITLE     Sequence organization of the human int-2 gene and its expression in
            teratocarcinoma cells
  JOURNAL   Oncogene 4 (4), 429-436 (1989)
   PUBMED   2470007
REFERENCE   10 (bases 1 to 1540)
  AUTHORS   Casey,G., Smith,R., McGillivray,D., Peters,G. and Dickson,C.
  TITLE     Characterization and chromosome assignment of the human homolog of
            int-2, a potential proto-oncogene
  JOURNAL   Mol Cell Biol 6 (2), 502-510 (1986)
   PUBMED   3023852
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AP006345.4 and BC113739.1.
            This sequence is a reference standard in the RefSeqGene project.
            
            On May 7, 2019 this sequence version replaced NM_005247.3.
            
            Summary: The protein encoded by this gene is a member of the
            fibroblast growth factor (FGF) family. FGF family members possess
            broad mitogenic and cell survival activities and are involved in a
            variety of biological processes including embryonic development,
            cell growth, morphogenesis, tissue repair, tumor growth and
            invasion. This gene was identified by its similarity with mouse
            fgf3/int-2, a proto-oncogene activated in virally induced mammary
            tumors in the mouse. Frequent amplification of this gene has been
            found in human tumors, which may be important for neoplastic
            transformation and tumor progression. Studies of the similar genes
            in mouse and chicken suggested the role in inner ear formation.
            [provided by RefSeq, Jul 2008].
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC113739.1, SRR3476690.433211.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03465403 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000334134.4/ ENSP00000334122.2
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-392               AP006345.4         79206-79597         c
            393-1284            BC113739.1         1-892
            1285-1540           AP006345.4         70149-70404         c
FEATURES             Location/Qualifiers
     source          1..1540
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="11"
                     /map="11q13.3"
     gene            1..1540
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /note="fibroblast growth factor 3"
                     /db_xref="GeneID:2248"
                     /db_xref="HGNC:HGNC:3681"
                     /db_xref="MIM:164950"
     exon            1..703
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /inference="alignment:Splign:2.1.0"
     CDS             484..1203
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /note="fibroblast growth factor 3 (murine mammary tumor
                     virus integration site (v-int-2) oncogene homolog); INT-2
                     proto-oncogene protein; murine mammary tumor virus
                     integration site 2, mouse; oncogene INT2; V-INT2 murine
                     mammary tumor virus integration site oncogene homolog;
                     FGF-3; proto-oncogene Int-2; heparin-binding growth factor
                     3"
                     /codon_start=1
                     /product="fibroblast growth factor 3 precursor"
                     /protein_id="NP_005238.1"
                     /db_xref="CCDS:CCDS8195.1"
                     /db_xref="GeneID:2248"
                     /db_xref="HGNC:HGNC:3681"
                     /db_xref="MIM:164950"
                     /translation="MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPR
                     RRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKR
                     GRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGK
                     GRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPD
                     NLEPSHVQASRLGSQLEASAH"
     sig_peptide     484..534
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     mat_peptide     535..1200
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /product="Fibroblast growth factor 3. /id=PRO_0000008946"
                     /note="propagated from UniProtKB/Swiss-Prot (P11487.1)"
     misc_feature    676..678
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (P11487.1); glycosylation site"
     misc_feature    1060..1200
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /note="propagated from UniProtKB/Swiss-Prot (P11487.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            704..807
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /inference="alignment:Splign:2.1.0"
     exon            808..1540
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1522..1527
                     /regulatory_class="polyA_signal_sequence"
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /note="hexamer: ATTAAA"
     polyA_site      1540
                     /gene="FGF3"
                     /gene_synonym="HBGF-3; INT2"
                     /note="major polyA site"
ORIGIN      
        1 agagccagga gggctttcgg gggcgtgggg cgcgctgcgg agcggagccg cggctcgacg
       61 gcggtgcgct ggcggcgagt gtatgcagac ggcgcccggc ccgaaccccg agccccgcgg
      121 ggctccccac ccgccggcct cccgcccctc ccgcgcctcc gcctggggac cacgtcggcc
      181 ttttgttggc gaaccgtcct ttctttcagc gctttgcgca gcaacggaaa tttcattgct
      241 cctgggtgga aattaaaggg actcgcgttc cctctctccc tctccctctc ccactctccc
      301 tctctttctc tctctcgccc acccttcccc cttcttcccc cacctttccc gcgaagccgg
      361 agtcagcatc tccaggcgcg ggatcccgct ccgagcacct cgcagctgtc cggctgccgc
      421 cccttccatg ggcgccgcgc tcgcctgcag ccgccgccgc cgcggggcgg gcgcgatgcc
      481 acgatgggcc taatctggct gctactgctc agcctgctgg agcccggctg gcccgcagcg
      541 ggccctgggg cgcggttgcg gcgcgatgcg ggcggccgtg gcggcgtcta cgagcacctt
      601 ggcggggcgc cccggcgccg caagctctac tgcgccacga agtaccacct ccagctgcac
      661 ccgagcggcc gcgtcaacgg cagcctggag aacagcgcct acagtatttt ggagataacg
      721 gcagtggagg tgggcattgt ggccatcagg ggtctcttct ccgggcggta cctggccatg
      781 aacaagaggg gacgactcta tgcttcggag cactacagcg ccgagtgcga gtttgtggag
      841 cggatccacg agctgggcta taatacgtat gcctcccggc tgtaccggac ggtgtctagt
      901 acgcctgggg cccgccggca gcccagcgcc gagagactgt ggtacgtgtc tgtgaacggc
      961 aagggccggc cccgcagggg cttcaagacc cgccgcacac agaagtcctc cctgttcctg
     1021 ccccgcgtgc tggaccacag ggaccacgag atggtgcggc agctacagag tgggctgccc
     1081 agaccccctg gtaagggggt ccagccccga cggcggcggc agaagcagag cccggataac
     1141 ctggagccct ctcacgttca ggcttcgaga ctgggctccc agctggaggc cagtgcgcac
     1201 tagctgggcc tggtggccac cgccagagct cctggcgaca tcttggcgtg gcagcctctt
     1261 gactctgact ctcctccttg agcccttgcc cctgcgtccc gcgtctgggt tctcagctat
     1321 ttccagagcc agctcaaatc agggtccagt gggaactgaa gagggcccaa gtcggagctc
     1381 ggagggggct gcctgcaatg cagggcattt gtgggtctgt gtggcaggaa gccggcaggg
     1441 aagggcctga gtgccagccc tggcagactg aggagcctcc caggagcagc ggggcagtgt
     1501 ggggctttgt gtcatcacaa cattaaagta ttttattcta
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for fibroblast growth factor 3 precursor (NP_005238.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.