Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_026492.4
FASTA Graphics
LOCUS NM_026492 50 bp mRNA linear ROD 08-AUG-2023 DEFINITION Mus musculus SSX member B1 (Ssxb1), mRNA. ACCESSION NM_026492 REGION: 456..505 VERSION NM_026492.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 50) AUTHORS Chen YT, Alpen B, Ono T, Gure AO, Scanlan MA, Biggs WH 3rd, Arden K, Nakayama E and Old LJ. TITLE Identification and characterization of mouse SSX genes: a multigene family on the X chromosome with restricted cancer/testis expression JOURNAL Genomics 82 (6), 628-636 (2003) PUBMED 14611804 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BX890632.7. On Mar 18, 2023 this sequence version replaced NM_026492.3. ##Evidence-Data-START## Transcript exon combination :: AK006218.1, AY244792.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849384 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-123 BX890632.7 109599-109721 124-250 BX890632.7 112166-112292 251-365 BX890632.7 112748-112862 366-455 BX890632.7 113166-113255 456-505 BX890632.7 113731-113780 506-581 BX890632.7 114386-114461 582-698 BX890632.7 117755-117871 699-879 BX890632.7 118275-118455 FEATURES Location/Qualifiers source 1..50 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 3.81 cM" gene <1..>50 /gene="Ssxb1" /gene_synonym="4930414C09Rik" /note="SSX member B1" /db_xref="GeneID:67985" /db_xref="MGI:MGI:1915235" CDS <1..>50 /gene="Ssxb1" /gene_synonym="4930414C09Rik" /note="synovial sarcoma, X member B, breakpoint 1" /codon_start=3 /product="synovial sarcoma, X member B1" /protein_id="NP_080768.1" /db_xref="CCDS:CCDS29997.1" /db_xref="GeneID:67985" /db_xref="MGI:MGI:1915235" /translation="METVSSCEKVPMEVLYEPKNICKAFQDISTYFSDEEWGKLTQWQ KSAYVYMKRNYIRMTDLGVTVNQPVFMRGKEQAKQSLVEGIEVHDSEDECFEGSFGVT PIKRMKLTSVTISFHNVEGSLASGENDCNLAETGGIQVNVWSHRLRERKYRVIYSEIS DTEEEEDDDY" exon 1..50 /gene="Ssxb1" /gene_synonym="4930414C09Rik" /inference="alignment:Splign:2.1.0" ORIGIN 1 atgaatgctt tgaaggatct tttggtgtga caccgataaa acgaatgaag //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on