Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_064298.3
FASTA Graphics
LOCUS NM_064298 476 bp mRNA linear INV 04-DEC-2024 DEFINITION Caenorhabditis elegans Nematode Specific Peptide family, group E (nspe-5), mRNA. ACCESSION NM_064298 VERSION NM_064298.3 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 476) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 476) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 476) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (17-OCT-2024) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 476) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003280). On May 27, 2020 this sequence version replaced NM_064298.2. FEATURES Location/Qualifiers source 1..476 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="II" gene 1..476 /gene="nspe-5" /locus_tag="CELE_Y38E10A.16" /db_xref="GeneID:189662" /db_xref="WormBase:WBGene00012594" CDS 140..364 /gene="nspe-5" /locus_tag="CELE_Y38E10A.16" /standard_name="Y38E10A.16" /note="Product from WormBase gene class nspe; Confirmed by transcript evidence" /codon_start=1 /product="Nematode Specific Peptide family, group E" /protein_id="NP_496699.1" /db_xref="GeneID:189662" /db_xref="WormBase:WBGene00012594" /translation="MSSSILFFIVLSLFLTTVSAGIIRDRRAIEDYWYSNGVVNNMVS DNIYGGSTSLGWAQVPHHLSPMFSPVFGGR" ORIGIN 1 tcatcggagg agaagagaga ttaacacatt tcaaaccttc cctgacactt ttgacgctga 61 caaacaaacc ttagcccagt tataaaaaga gataggtaat ccatttccaa tcaaactaaa 121 ccaaatctaa atcttcaaaa tgagctcatc cattctcttc ttcatcgtcc tctccctttt 181 ccttactacg gtatccgctg gaatcatccg ggaccgtcgt gcaattgagg actattggta 241 ttcaaatgga gttgttaaca atatggtgtc agacaacatt tatggaggat ccacttctct 301 tggatgggca caagttccac accacctcag cccaatgttc tcgccggtgt ttggaggacg 361 atgaggtgtt ttgacttgaa gaatttctga aattttattt acatgactgc agtatttcaa 421 tttgaatttg atctctattt ttttaatgga aaatgaatat tttgacgatg aagaaa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on