U.S. flag

An official website of the United States government

Caenorhabditis elegans Major sperm protein 77/79 (msp-77), partial mRNA

NCBI Reference Sequence: NM_069380.5

FASTA Graphics 

LOCUS       NM_069380                384 bp    mRNA    linear   INV 04-DEC-2024
DEFINITION  Caenorhabditis elegans Major sperm protein 77/79 (msp-77), partial
            mRNA.
ACCESSION   NM_069380
VERSION     NM_069380.5
DBLINK      BioProject: PRJNA158
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 384)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 384)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 384)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (17-OCT-2024) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 384)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            
            On Apr 15, 2020 this sequence version replaced NM_069380.4.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..384
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>384
                     /gene="msp-77"
                     /locus_tag="CELE_F32B6.6"
                     /db_xref="GeneID:177844"
                     /db_xref="WormBase:WBGene00003464"
     CDS             1..384
                     /gene="msp-77"
                     /locus_tag="CELE_F32B6.6"
                     /standard_name="F32B6.6"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Major sperm protein 77/79"
                     /protein_id="NP_501781.1"
                     /db_xref="GeneID:177844"
                     /db_xref="WormBase:WBGene00003464"
                     /translation="MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGY
                     GIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAA
                     KQFRREWFQGDGMARRKNLPIEYNP"
ORIGIN      
        1 atggcccaat ccgtcccacc aggagacatc caaactcaac cgggtaccaa gatcgtcttc
       61 aatgctccat acgatgacaa gcacacctac cacatcaagg tgatcaactc atcggctcgg
      121 cgtattggat atggtatcaa gaccaccaat atgaagagac ttggagttga tccaccatgt
      181 ggagttctcg acccaaagga agctgtgctt cttgctgttt cctgcgatgc cttcgccttc
      241 ggacaagagg ataccaacaa cgaccgtatc actgttgagt ggaccaacac cccggatggt
      301 gctgccaagc aattccgtcg tgaatggttc cagggagacg gtatggctcg tcgtaagaac
      361 ctcccaattg agtacaaccc atag
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.