Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_070557.3
FASTA Graphics
LOCUS NM_070557 832 bp mRNA linear INV 04-DEC-2024 DEFINITION Caenorhabditis elegans Transmembrane protein (Y51H4A.1), mRNA. ACCESSION NM_070557 VERSION NM_070557.3 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 832) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 832) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 832) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (17-OCT-2024) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 832) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003282). On Sep 4, 2019 this sequence version replaced NM_070557.2. FEATURES Location/Qualifiers source 1..832 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="IV" gene 1..832 /gene="Y51H4A.1" /locus_tag="CELE_Y51H4A.1" /db_xref="GeneID:190144" /db_xref="WormBase:WBGene00013098" CDS 104..748 /gene="Y51H4A.1" /locus_tag="CELE_Y51H4A.1" /standard_name="Y51H4A.1" /note="Confirmed by transcript evidence" /codon_start=1 /product="Transmembrane protein" /protein_id="NP_502958.2" /db_xref="GeneID:190144" /db_xref="WormBase:WBGene00013098" /translation="MLLVLVLLIFTILLLFFYFGKLLIFGKQKIVENSIEKINSNGIS LAENSKNLEKSSQSNDPENAEETEMVIELHTEAAPVENYLEEEIQIKVPEVEEDTEKT PAGSPKSTSSCISSEILSEQSIEFSSISPRPSSFPLDFATSSYSAPLSNFTRETPNIV PRMMSEEFESLHKCIEKRKSDIRDLLRRIQSAKRRHRRFSEHLQQVQHDHHIDY" ORIGIN 1 cttcccctat tttcttgtcc atctaaacct ccgtgccgcc tactccaaaa tgcatatatg 61 agcatctttt tgctctcaat tcttctgtcc agatggttta caaatgttgc tagttttggt 121 tttattgatt ttcactattt tacttttatt tttctatttc gggaaattgc tgatttttgg 181 aaagcagaaa attgtggaaa attcgataga gaaaatcaat tccaatggaa tttcactagc 241 agaaaattcg aaaaatttgg aaaaatcttc acaatcaaat gatcccgaga atgcagaaga 301 aactgaaatg gtcatagaac ttcacacaga agcagctcca gttgaaaatt atctggaaga 361 agaaatacaa ataaaagttc ccgaagttga agaagacacc gaaaaaacac cggctgggtc 421 accgaaatcc acgtcatcat gtatttcttc agagatttta tcggaacaat cgattgagtt 481 ctcatcaata tctccccgcc catcatcctt ccctttggac tttgccacgt catcatactc 541 tgctccatta tccaatttca ctcgagaaac cccaaatatt gtgcctagaa tgatgtcaga 601 agagtttgaa tccttgcata aatgcattga aaaaagaaaa tctgatataa gggatttgtt 661 gaggagaata cagtcggcga agagaaggca taggagattc agtgaacact tgcaacaggt 721 acaacatgat catcatatcg attattgaac aattgttttt tccaaaaatt aaaataaaaa 781 ttttactgtt tcccaatttt gacttaaaat cttcaaattt ttttaaaatt gc //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on