Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_074584.7
FASTA Graphics
LOCUS NM_074584 779 bp mRNA linear INV 04-DEC-2024 DEFINITION Caenorhabditis elegans ShKT domain-containing protein (F35E8.10), partial mRNA. ACCESSION NM_074584 VERSION NM_074584.7 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 779) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 779) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 779) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (17-OCT-2024) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 779) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003283). On Apr 15, 2020 this sequence version replaced NM_074584.6. COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..779 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="V" gene 1..>779 /gene="F35E8.10" /locus_tag="CELE_F35E8.10" /db_xref="GeneID:185301" /db_xref="WormBase:WBGene00009423" CDS 30..779 /gene="F35E8.10" /locus_tag="CELE_F35E8.10" /standard_name="F35E8.10" /note="Partially confirmed by transcript evidence" /codon_start=1 /product="ShKT domain-containing protein" /protein_id="NP_506985.1" /db_xref="GeneID:185301" /db_xref="WormBase:WBGene00009423" /translation="MIALVSFILALLAPQASAVIGGDLNCTSYNGTAFVWNAAATACS NVISDSSCAVLYPAPVAADGYPSPGRDQQRPLACYTTATATPAAVVQDMKNAAQSTCP RTCGLCCQTSGYNCPNVAYPRLNCGTITASQCLSPVWRPIIAADCPSACGFCNEGGCV DAIPDCANDIRICTAAGLETFVATYCQRTCGKCASSTTTRSSASTGTCSSFIADTSPS CAAWAGKNFCTNTFYTLAQRRQYCATTCRIC" ORIGIN 1 acacagagaa gctcaaataa atcagcagaa tgattgcttt ggtttcattc atcctggcac 61 ttctggcccc acaagccagt gcagtcattg gaggagatct taactgtaca tcttacaacg 121 gaactgcttt tgtctggaac gcagctgcca ctgcatgcag caatgtcatc tccgattcat 181 cctgcgcagt tctgtaccct gccccagttg cagctgacgg atatccatca ccaggaagag 241 atcagcagag accattggct tgttatacga ctgctaccgc gactccagct gctgtagttc 301 aagacatgaa gaatgcagct cagagcacat gcccaagaac ttgcggatta tgttgtcaga 361 cttctggtta caactgccca aatgttgcat atccacgtct caactgtggc accatcaccg 421 cctcccaatg tctgtcaccg gtttggagac caattatcgc tgcggactgt ccatctgcct 481 gcggattctg caatgaggga ggatgcgttg atgctattcc cgactgtgca aatgacataa 541 gaatttgcac cgccgctgga ctcgaaacct ttgtggccac ctactgccag agaacctgtg 601 gaaaatgtgc atcttcaaca actacccgat catctgcttc tactggaacc tgttcttctt 661 tcatcgctga taccagtcca tcatgtgctg cctgggctgg aaagaacttc tgcaccaaca 721 ctttctacac tctcgcacag agaagacaat actgtgcgac tacttgcaga atctgctga //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on