U.S. flag

An official website of the United States government

Arabidopsis thaliana Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (AT3G06040), mRNA

NCBI Reference Sequence: NM_111479.5

FASTA Graphics 

LOCUS       NM_111479               1000 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana Ribosomal protein L12/ ATP-dependent Clp
            protease adaptor protein ClpS family protein (AT3G06040), mRNA.
ACCESSION   NM_111479
VERSION     NM_111479.5
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1000)
  AUTHORS   Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M.,
            Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B.,
            Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De
            Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P.,
            Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F.,
            Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V.,
            Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S.,
            Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P.,
            Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S.,
            Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H.,
            Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M.,
            Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A.,
            Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C.,
            Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P.,
            Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M.,
            Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S.,
            Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L.,
            Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A.,
            Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B.,
            Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J.,
            Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X.,
            Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M.,
            Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S.,
            Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A.,
            Yamada,M., Yasuda,M. and Tabata,S.
  CONSRTM   European Union Chromosome 3 Arabidopsis Sequencing Consortium;
            Institute for Genomic Research; Kazusa DNA Research Institute
  TITLE     Sequence and analysis of chromosome 3 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 820-822 (2000)
   PUBMED   11130713
REFERENCE   2  (bases 1 to 1000)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1000)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1000)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003074).
            
            On Sep 12, 2016 this sequence version replaced NM_111479.4.
FEATURES             Location/Qualifiers
     source          1..1000
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="3"
                     /ecotype="Columbia"
     gene            1..1000
                     /locus_tag="AT3G06040"
                     /gene_synonym="F24F17.2; F24F17_2"
                     /db_xref="Araport:AT3G06040"
                     /db_xref="GeneID:819777"
                     /db_xref="TAIR:AT3G06040"
     CDS             241..801
                     /locus_tag="AT3G06040"
                     /gene_synonym="F24F17.2; F24F17_2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL294617.1,INSD:ES024738.1,INSD:EL311539.1,
                     INSD:BP819431.1,INSD:EL288333.1,INSD:ES031822.1,
                     INSD:DR381790.1,INSD:EL044043.1,INSD:AV787650.1,
                     INSD:EL970831.1,INSD:EL238377.1,INSD:ES035689.1,
                     INSD:EL991366.1,INSD:EL979506.1,INSD:DR347052.1,
                     INSD:ES143772.1,INSD:ES043043.1,INSD:ES189964.1,
                     INSD:BP655790.1,INSD:AV824552.1,INSD:BP798165.1,
                     INSD:ES144436.1,INSD:ES011834.1,INSD:DR347053.1,
                     INSD:CB264828.1,INSD:AV552004.1,INSD:EL994284.1,
                     INSD:ES034941.1,INSD:EL984811.1,INSD:ES211030.1,
                     INSD:BP834498.2,INSD:ES013452.1,INSD:EL241917.1,
                     INSD:AV542170.1,INSD:EL177654.1,INSD:AV786619.1,
                     INSD:ES208715.1,INSD:EH903703.1,INSD:EL993866.1,
                     INSD:ES208850.1,INSD:ES004351.1,INSD:ES017258.1,
                     INSD:EL134239.1,INSD:EH857538.1,INSD:ES088207.1,
                     INSD:BP610803.1,INSD:AI995493.1,INSD:ES131793.1,
                     INSD:DR371393.1,INSD:ES011706.1,INSD:EL111572.1,
                     INSD:ES006902.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AY063991.1,INSD:AY096690.1"
                     /note="Ribosomal protein L12/ ATP-dependent Clp protease
                     adaptor protein ClpS family protein; FUNCTIONS IN:
                     structural constituent of ribosome; INVOLVED IN:
                     translation; LOCATED IN: ribosome, intracellular, large
                     ribosomal subunit; EXPRESSED IN: 21 plant structures;
                     EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
                     DOMAIN/s: Ribosomal protein L12, chloroplast
                     (InterPro:IPR015608), Ribosomal protein L7/L12,
                     C-terminal/adaptor protein ClpS-like (InterPro:IPR014719),
                     Ribosomal protein L7/L12, C-terminal (InterPro:IPR013823);
                     BEST Arabidopsis thaliana protein match is: Ribosomal
                     protein L7/L12, oligomerisation;Ribosomal protein L7/L12,
                     C-terminal/adaptor protein ClpS-like (TAIR:AT1G70190.2);
                     Has 8332 Blast hits to 8332 proteins in 2728 species:
                     Archae - 0; Bacteria - 5601; Metazoa - 194; Fungi - 132;
                     Plants - 253; Viruses - 0; Other Eukaryotes - 2152
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="Ribosomal protein L12/ ATP-dependent Clp
                     protease adaptor protein ClpS family protein"
                     /protein_id="NP_187255.1"
                     /db_xref="GeneID:819777"
                     /db_xref="TAIR:AT3G06040"
                     /db_xref="Araport:AT3G06040"
                     /translation="MKLISLVRNVRSRQCQPEVIWSVQVRFLQQDSVSKAKPKKYKYP
                     SVYDPYGPRPQPSSKIMELAERIAALSPEERKQIGPALNEHLRLPKQQMISSDGIGAK
                     QDTGAGNVEEKKEKTAFDVKLEKFNASDKIKVIKEVRTFTSLGLKEAKELVEKVPAIL
                     KQGVTKEEANEIIAKIKAVGGIAVME"
ORIGIN      
        1 gatccttatt gggcttggcc catagacaaa agtaattttg agccgaaaag aggaatcttt
       61 ccactctaaa ccctatgcgt gactcatctc cgtctctcac agtaataatc aagtcagagc
      121 cggcgaagct tgccgtttcc gccgttggag gagagttttt actgttgctg tcctgttgac
      181 attttgagac atgaaatgat cttgggttga tgtttgtatg gtagcagagg aatagtagtc
      241 atgaagctta tttcacttgt tagaaacgtt cgttctcgcc aatgtcaacc ggaagtaatc
      301 tggtctgtgc aagttcgttt cttgcagcaa gactctgtct cgaaagctaa acccaagaaa
      361 tacaaatacc cgtcagttta tgatccgtat ggtcctagac cccagccttc aagcaaaatc
      421 atggagctag ctgagcgtat agctgcttta tctccagaag aaagaaaaca gattggtcct
      481 gcactcaatg aacacctgag gcttccaaaa caacagatga tttcatcgga cggcattgga
      541 gcaaaacaag ataccggagc tgggaatgta gaggagaaga aggagaagac ggctttcgat
      601 gtgaagttgg agaagtttaa tgcatctgat aagatcaaag tgataaaaga agtgagaacg
      661 ttcacaagtt tgggtctgaa ggaagcgaaa gagcttgtgg agaaagtccc ggctattctt
      721 aaacaaggtg tgacaaagga agaagctaat gaaatcatag ccaagatcaa agctgttggt
      781 ggaatcgcag ttatggagta ggtgactttt gacacttcga ttgttttttt gtttgattca
      841 ctatttggta ttgtgatcac atcttggtac ttaaggtaga tgttttgtaa taacaaatcg
      901 attacttgac attgagtttt caagaacttt ggtcaattgt ttgccttctc tttggaactt
      961 gttcttgtcc tctatcctta tattagaaac gatgccgtat
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq alternative splicing
    See 3 reference mRNA sequence splice variants for the AT3G06040 gene.
  • RefSeq protein product
    See the reference protein sequence for Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (NP_187255.1).

More about the AT3G06040 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.