U.S. flag

An official website of the United States government

Arabidopsis thaliana Ubiquitin-like superfamily protein (AT4G32270), mRNA

NCBI Reference Sequence: NM_119379.3

FASTA Graphics 

LOCUS       NM_119379               1046 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana Ubiquitin-like superfamily protein
            (AT4G32270), mRNA.
ACCESSION   NM_119379
VERSION     NM_119379.3
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1046)
  AUTHORS   Mayer,K., Schuller,C., Wambutt,R., Murphy,G., Volckaert,G.,
            Pohl,T., Dusterhoft,A., Stiekema,W., Entian,K.D., Terryn,N.,
            Harris,B., Ansorge,W., Brandt,P., Grivell,L., Rieger,M.,
            Weichselgartner,M., de Simone,V., Obermaier,B., Mache,R.,
            Muller,M., Kreis,M., Delseny,M., Puigdomenech,P., Watson,M.,
            Schmidtheini,T., Reichert,B., Portatelle,D., Perez-Alonso,M.,
            Boutry,M., Bancroft,I., Vos,P., Hoheisel,J., Zimmermann,W.,
            Wedler,H., Ridley,P., Langham,S.A., McCullagh,B., Bilham,L.,
            Robben,J., Van der Schueren,J., Grymonprez,B., Chuang,Y.J.,
            Vandenbussche,F., Braeken,M., Weltjens,I., Voet,M., Bastiaens,I.,
            Aert,R., Defoor,E., Weitzenegger,T., Bothe,G., Ramsperger,U.,
            Hilbert,H., Braun,M., Holzer,E., Brandt,A., Peters,S., van
            Staveren,M., Dirske,W., Mooijman,P., Klein Lankhorst,R., Rose,M.,
            Hauf,J., Kotter,P., Berneiser,S., Hempel,S., Feldpausch,M.,
            Lamberth,S., Van den Daele,H., De Keyser,A., Buysshaert,C.,
            Gielen,J., Villarroel,R., De Clercq,R., Van Montagu,M., Rogers,J.,
            Cronin,A., Quail,M., Bray-Allen,S., Clark,L., Doggett,J., Hall,S.,
            Kay,M., Lennard,N., McLay,K., Mayes,R., Pettett,A.,
            Rajandream,M.A., Lyne,M., Benes,V., Rechmann,S., Borkova,D.,
            Blocker,H., Scharfe,M., Grimm,M., Lohnert,T.H., Dose,S., de
            Haan,M., Maarse,A., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M.,
            Fartmann,B., Granderath,K., Dauner,D., Herzl,A., Neumann,S.,
            Argiriou,A., Vitale,D., Liguori,R., Piravandi,E., Massenet,O.,
            Quigley,F., Clabauld,G., Mundlein,A., Felber,R., Schnabl,S.,
            Hiller,R., Schmidt,W., Lecharny,A., Aubourg,S., Chefdor,F.,
            Cooke,R., Berger,C., Montfort,A., Casacuberta,E., Gibbons,T.,
            Weber,N., Vandenbol,M., Bargues,M., Terol,J., Torres,A.,
            Perez-Perez,A., Purnelle,B., Bent,E., Johnson,S., Tacon,D.,
            Jesse,T., Heijnen,L., Schwarz,S., Scholler,P., Heber,S., Francs,P.,
            Bielke,C., Frishman,D., Haase,D., Lemcke,K., Mewes,H.W.,
            Stocker,S., Zaccaria,P., Bevan,M., Wilson,R.K., de la Bastide,M.,
            Habermann,K., Parnell,L., Dedhia,N., Gnoj,L., Schutz,K., Huang,E.,
            Spiegel,L., Sehkon,M., Murray,J., Sheet,P., Cordes,M.,
            Abu-Threideh,J., Stoneking,T., Kalicki,J., Graves,T., Harmon,G.,
            Edwards,J., Latreille,P., Courtney,L., Cloud,J., Abbott,A.,
            Scott,K., Johnson,D., Minx,P., Bentley,D., Fulton,B., Miller,N.,
            Greco,T., Kemp,K., Kramer,J., Fulton,L., Mardis,E., Dante,M.,
            Pepin,K., Hillier,L., Nelson,J., Spieth,J., Ryan,E., Andrews,S.,
            Geisel,C., Layman,D., Du,H., Ali,J., Berghoff,A., Jones,K.,
            Drone,K., Cotton,M., Joshu,C., Antonoiu,B., Zidanic,M., Strong,C.,
            Sun,H., Lamar,B., Yordan,C., Ma,P., Zhong,J., Preston,R., Vil,D.,
            Shekher,M., Matero,A., Shah,R., Swaby,I.K., O'Shaughnessy,A.,
            Rodriguez,M., Hoffmann,J., Till,S., Granat,S., Shohdy,N.,
            Hasegawa,A., Hameed,A., Lodhi,M., Johnson,A., Chen,E., Marra,M.,
            Martienssen,R. and McCombie,W.R.
  TITLE     Sequence and analysis of chromosome 4 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 769-777 (1999)
   PUBMED   10617198
REFERENCE   2  (bases 1 to 1046)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1046)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1046)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003075).
            
            On Sep 12, 2016 this sequence version replaced NM_119379.2.
FEATURES             Location/Qualifiers
     source          1..1046
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="4"
                     /ecotype="Columbia"
     gene            1..1046
                     /locus_tag="AT4G32270"
                     /gene_synonym="F10M6.90; F10M6_90"
                     /db_xref="Araport:AT4G32270"
                     /db_xref="GeneID:829360"
                     /db_xref="TAIR:AT4G32270"
     CDS             181..900
                     /locus_tag="AT4G32270"
                     /gene_synonym="F10M6.90; F10M6_90"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES029785.1,INSD:EH914536.1,INSD:EL996438.1,
                     INSD:AV551968.1,INSD:AV527876.1,INSD:BP783117.1,
                     INSD:AV521184.1,INSD:AV541690.1,INSD:DR224799.1,
                     INSD:BX841468.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:AK117743.1,INSD:BX829232.1,INSD:BX828967.1,
                     INSD:BX828756.1"
                     /note="Ubiquitin-like superfamily protein; FUNCTIONS IN:
                     molecular_function unknown; INVOLVED IN:
                     biological_process unknown; LOCATED IN: plasma membrane;
                     EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
                     growth stages; BEST Arabidopsis thaliana protein match is:
                     Ubiquitin-like superfamily protein (TAIR:AT5G25340.1); Has
                     132 Blast hits to 130 proteins in 45 species: Archae - 0;
                     Bacteria - 0; Metazoa - 63; Fungi - 0; Plants - 66;
                     Viruses - 0; Other Eukaryotes - 3 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Ubiquitin-like superfamily protein"
                     /protein_id="NP_194954.2"
                     /db_xref="GeneID:829360"
                     /db_xref="TAIR:AT4G32270"
                     /db_xref="Araport:AT4G32270"
                     /translation="MDVPPRRSLAASLSPLRLIDGLPRRRSFNYNQMPEEPIKLTVLK
                     LDGSSFGIQVLKTATVGELKMAVEAAFSHLPISGPGKISWPHVWGQFCLSYEDKRLIN
                     ESEYLTEFGIKDGDQLRFIRHISNYCMLMVKHKSKTPRVSSFKQLKLFSTTPETRKKN
                     VIREVEEDGVVDSIPRSQPSFLATVLGGLLSYKSTPSQRGTKYRNVTASRVFNKLIAR
                     FRFKCNSEKDVWNRKKLISET"
ORIGIN      
        1 gatcccttaa ccatgatttc cttcaaagta tattcccctt cctcatcctc ttcccatgct
       61 catggtatca atcttccact ctgacccaac tcaagctctg atttctccta ctccgtcgcc
      121 aaaaatcttg gaagtagatg tcttagcccg ggaaaatcaa attttctcaa taatcaatct
      181 atggacgttc caccacgccg ctctttggct gcgtctctct cgcctctccg gctaatcgat
      241 ggactccctc gtcggaggag tttcaattat aatcagatgc ctgaagagcc catcaaactc
      301 actgttctca agcttgatgg atcttccttt ggtattcaag tgttgaagac agcgacagta
      361 ggggagctca agatggcagt agaagctgcg ttttctcact tgcccatctc aggccctggc
      421 aagatctcat ggccgcatgt ttggggacaa ttctgcttat cttatgaaga taaaagattg
      481 attaatgagt ctgagtacct cactgaattt ggcattaaag acggcgatca gcttcggttc
      541 atccgccata tctcaaacta ctgcatgtta atggtgaagc ataagagcaa gacaccccgt
      601 gtttcttctt tcaaacaact caaactgttc tcaaccacac cggaaacccg gaaaaagaac
      661 gtaataaggg aagttgaaga agacggtgtt gttgactcca tccctcggag ccaaccaagc
      721 tttctagcaa ctgtattggg aggtttgctc tcttacaagt cgacgccaag tcaacgaggt
      781 actaaataca gaaacgtgac tgcaagtaga gtttttaaca aactcattgc aaggtttcgt
      841 ttcaagtgta attccgagaa ggatgtgtgg aacagaaaaa aactcatatc cgaaacctaa
      901 aaaaaagcac tccttttcta tcatttgatt cttgtagaga ttttgatttc ctaatcttgg
      961 tgtttatata caaacttgga tgttgtgtgt gtgcaaaatg aataaggcat tgtgtattta
     1021 cgtttgtagt ggatataatt gcaacc
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for Ubiquitin-like superfamily protein (NP_194954.2).

More about the AT4G32270 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.