LOCUS NM_119865 1116 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana initiation factor 4A-like protein (AT4G37020),
mRNA.
ACCESSION NM_119865
VERSION NM_119865.4
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 1116)
AUTHORS Mayer,K., Schuller,C., Wambutt,R., Murphy,G., Volckaert,G.,
Pohl,T., Dusterhoft,A., Stiekema,W., Entian,K.D., Terryn,N.,
Harris,B., Ansorge,W., Brandt,P., Grivell,L., Rieger,M.,
Weichselgartner,M., de Simone,V., Obermaier,B., Mache,R.,
Muller,M., Kreis,M., Delseny,M., Puigdomenech,P., Watson,M.,
Schmidtheini,T., Reichert,B., Portatelle,D., Perez-Alonso,M.,
Boutry,M., Bancroft,I., Vos,P., Hoheisel,J., Zimmermann,W.,
Wedler,H., Ridley,P., Langham,S.A., McCullagh,B., Bilham,L.,
Robben,J., Van der Schueren,J., Grymonprez,B., Chuang,Y.J.,
Vandenbussche,F., Braeken,M., Weltjens,I., Voet,M., Bastiaens,I.,
Aert,R., Defoor,E., Weitzenegger,T., Bothe,G., Ramsperger,U.,
Hilbert,H., Braun,M., Holzer,E., Brandt,A., Peters,S., van
Staveren,M., Dirske,W., Mooijman,P., Klein Lankhorst,R., Rose,M.,
Hauf,J., Kotter,P., Berneiser,S., Hempel,S., Feldpausch,M.,
Lamberth,S., Van den Daele,H., De Keyser,A., Buysshaert,C.,
Gielen,J., Villarroel,R., De Clercq,R., Van Montagu,M., Rogers,J.,
Cronin,A., Quail,M., Bray-Allen,S., Clark,L., Doggett,J., Hall,S.,
Kay,M., Lennard,N., McLay,K., Mayes,R., Pettett,A.,
Rajandream,M.A., Lyne,M., Benes,V., Rechmann,S., Borkova,D.,
Blocker,H., Scharfe,M., Grimm,M., Lohnert,T.H., Dose,S., de
Haan,M., Maarse,A., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M.,
Fartmann,B., Granderath,K., Dauner,D., Herzl,A., Neumann,S.,
Argiriou,A., Vitale,D., Liguori,R., Piravandi,E., Massenet,O.,
Quigley,F., Clabauld,G., Mundlein,A., Felber,R., Schnabl,S.,
Hiller,R., Schmidt,W., Lecharny,A., Aubourg,S., Chefdor,F.,
Cooke,R., Berger,C., Montfort,A., Casacuberta,E., Gibbons,T.,
Weber,N., Vandenbol,M., Bargues,M., Terol,J., Torres,A.,
Perez-Perez,A., Purnelle,B., Bent,E., Johnson,S., Tacon,D.,
Jesse,T., Heijnen,L., Schwarz,S., Scholler,P., Heber,S., Francs,P.,
Bielke,C., Frishman,D., Haase,D., Lemcke,K., Mewes,H.W.,
Stocker,S., Zaccaria,P., Bevan,M., Wilson,R.K., de la Bastide,M.,
Habermann,K., Parnell,L., Dedhia,N., Gnoj,L., Schutz,K., Huang,E.,
Spiegel,L., Sehkon,M., Murray,J., Sheet,P., Cordes,M.,
Abu-Threideh,J., Stoneking,T., Kalicki,J., Graves,T., Harmon,G.,
Edwards,J., Latreille,P., Courtney,L., Cloud,J., Abbott,A.,
Scott,K., Johnson,D., Minx,P., Bentley,D., Fulton,B., Miller,N.,
Greco,T., Kemp,K., Kramer,J., Fulton,L., Mardis,E., Dante,M.,
Pepin,K., Hillier,L., Nelson,J., Spieth,J., Ryan,E., Andrews,S.,
Geisel,C., Layman,D., Du,H., Ali,J., Berghoff,A., Jones,K.,
Drone,K., Cotton,M., Joshu,C., Antonoiu,B., Zidanic,M., Strong,C.,
Sun,H., Lamar,B., Yordan,C., Ma,P., Zhong,J., Preston,R., Vil,D.,
Shekher,M., Matero,A., Shah,R., Swaby,I.K., O'Shaughnessy,A.,
Rodriguez,M., Hoffmann,J., Till,S., Granat,S., Shohdy,N.,
Hasegawa,A., Hameed,A., Lodhi,M., Johnson,A., Chen,E., Marra,M.,
Martienssen,R. and McCombie,W.R.
TITLE Sequence and analysis of chromosome 4 of the plant Arabidopsis
thaliana
JOURNAL Nature 402 (6763), 769-777 (1999)
PUBMED 10617198
REFERENCE 2 (bases 1 to 1116)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 1116)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 1116)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003075).
On Sep 12, 2016 this sequence version replaced NM_119865.3.
FEATURES Location/Qualifiers
source 1..1116
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="4"
/ecotype="Columbia"
gene 1..1116
/locus_tag="AT4G37020"
/db_xref="Araport:AT4G37020"
/db_xref="GeneID:829856"
/db_xref="TAIR:AT4G37020"
CDS 158..796
/locus_tag="AT4G37020"
/inference="Similar to RNA sequence,
EST:INSD:AA394779.1,INSD:BP866441.1,INSD:AI994890.1,
INSD:AA395164.1,INSD:EH808442.1,INSD:AU236641.1,
INSD:AU227596.1"
/inference="Similar to RNA sequence,
mRNA:INSD:BX828429.1,INSD:AK228495.1,INSD:AF325002.2"
/note="BEST Arabidopsis thaliana protein match is:
eukaryotic initiation factor 4A-III (TAIR:AT3G19760.1);
Has 30201 Blast hits to 17322 proteins in 780 species:
Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi -
3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996
(source: NCBI BLink)."
/codon_start=1
/product="initiation factor 4A-like protein"
/protein_id="NP_568013.1"
/db_xref="GeneID:829856"
/db_xref="TAIR:AT4G37020"
/db_xref="Araport:AT4G37020"
/translation="MDSMEAPSLPFQSPSRSSQQLHFYLAVDRPQFKMETVVELLGVL
GRRPWLPIVVCCSSRDELDAVCSSLSTLPYISLAALYSDLADRERAMVIEKFRQATIN
WNQQLNSVVEEGLEESENGKEEKTSHLVVVTDVCLPLLSSGESSLSARVLINYELPTK
KETYTRRITTCLASGGIVINMVVGGEVTTLKSLEESSGILIAEMPINISEIL"
ORIGIN
1 cgatgttgtt tagatctgat acttacatat aaccaaacga cgacgttgct agagtaataa
61 atctcaaaag actggaaacg actgcgtata agtccgtgac ctggttaccg gagcgtaact
121 tctccggcga attggacaat tttgagaaag acggattatg gactccatgg aagctccatc
181 tctaccattt caatctccct ctcgttccag tcaacaattg catttctacc tcgccgtgga
241 tcgtccccaa ttcaaaatgg agactgtagt ggaattatta ggcgttctag gtcgtcgtcc
301 atggcttccg attgtagtct gttgcagctc tcgtgacgaa cttgacgccg tctgttcttc
361 cttatccact cttccttaca tttccttagc cgctttgtac agcgatctag cagatagaga
421 acgagctatg gttatagaga aattcaggca agcaacaatc aactggaacc agcaacttaa
481 ctctgtggta gaagaaggtt tggaagagag tgaaaacgga aaagaagaaa agacatctca
541 tttggtagtt gtgaccgatg tttgccttcc gttactctca tcaggagaat cttctctatc
601 cgcacgcgtt ctcataaact acgagcttcc tacaaagaag gaaacatata caaggcgtat
661 aacaacttgc ttagcttcag gtggaatagt cataaacatg gttgttggag gtgaagtaac
721 gactctcaaa agcctcgaag aaagcagtgg catactcatc gctgagatgc caatcaatat
781 ttctgaaatc ttataacaac acatggatct ccgatctgaa gaattctaaa tggggttaat
841 ggctcttaag ccttttgaag gactagagga gatgaatggt ggattgataa cgctttattt
901 gtttgattgt atccagatgt ctcttgacca ttgcgctcaa atcatcaaag ccaaacttat
961 tgtaaaacca gtttcttttt ttcttatatt attaaagaat gttgaaacga aagaaagttt
1021 tgttctttct cttgtgtata ttatcaacat acatgtacat caaattgcaa ttttcttttg
1081 tagctcccta ctagttaacc tatggtttag tacgta
//