U.S. flag

An official website of the United States government

Arabidopsis thaliana initiation factor 4A-like protein (AT4G37020), mRNA

NCBI Reference Sequence: NM_119865.4

FASTA Graphics 

LOCUS       NM_119865               1116 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana initiation factor 4A-like protein (AT4G37020),
            mRNA.
ACCESSION   NM_119865
VERSION     NM_119865.4
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1116)
  AUTHORS   Mayer,K., Schuller,C., Wambutt,R., Murphy,G., Volckaert,G.,
            Pohl,T., Dusterhoft,A., Stiekema,W., Entian,K.D., Terryn,N.,
            Harris,B., Ansorge,W., Brandt,P., Grivell,L., Rieger,M.,
            Weichselgartner,M., de Simone,V., Obermaier,B., Mache,R.,
            Muller,M., Kreis,M., Delseny,M., Puigdomenech,P., Watson,M.,
            Schmidtheini,T., Reichert,B., Portatelle,D., Perez-Alonso,M.,
            Boutry,M., Bancroft,I., Vos,P., Hoheisel,J., Zimmermann,W.,
            Wedler,H., Ridley,P., Langham,S.A., McCullagh,B., Bilham,L.,
            Robben,J., Van der Schueren,J., Grymonprez,B., Chuang,Y.J.,
            Vandenbussche,F., Braeken,M., Weltjens,I., Voet,M., Bastiaens,I.,
            Aert,R., Defoor,E., Weitzenegger,T., Bothe,G., Ramsperger,U.,
            Hilbert,H., Braun,M., Holzer,E., Brandt,A., Peters,S., van
            Staveren,M., Dirske,W., Mooijman,P., Klein Lankhorst,R., Rose,M.,
            Hauf,J., Kotter,P., Berneiser,S., Hempel,S., Feldpausch,M.,
            Lamberth,S., Van den Daele,H., De Keyser,A., Buysshaert,C.,
            Gielen,J., Villarroel,R., De Clercq,R., Van Montagu,M., Rogers,J.,
            Cronin,A., Quail,M., Bray-Allen,S., Clark,L., Doggett,J., Hall,S.,
            Kay,M., Lennard,N., McLay,K., Mayes,R., Pettett,A.,
            Rajandream,M.A., Lyne,M., Benes,V., Rechmann,S., Borkova,D.,
            Blocker,H., Scharfe,M., Grimm,M., Lohnert,T.H., Dose,S., de
            Haan,M., Maarse,A., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M.,
            Fartmann,B., Granderath,K., Dauner,D., Herzl,A., Neumann,S.,
            Argiriou,A., Vitale,D., Liguori,R., Piravandi,E., Massenet,O.,
            Quigley,F., Clabauld,G., Mundlein,A., Felber,R., Schnabl,S.,
            Hiller,R., Schmidt,W., Lecharny,A., Aubourg,S., Chefdor,F.,
            Cooke,R., Berger,C., Montfort,A., Casacuberta,E., Gibbons,T.,
            Weber,N., Vandenbol,M., Bargues,M., Terol,J., Torres,A.,
            Perez-Perez,A., Purnelle,B., Bent,E., Johnson,S., Tacon,D.,
            Jesse,T., Heijnen,L., Schwarz,S., Scholler,P., Heber,S., Francs,P.,
            Bielke,C., Frishman,D., Haase,D., Lemcke,K., Mewes,H.W.,
            Stocker,S., Zaccaria,P., Bevan,M., Wilson,R.K., de la Bastide,M.,
            Habermann,K., Parnell,L., Dedhia,N., Gnoj,L., Schutz,K., Huang,E.,
            Spiegel,L., Sehkon,M., Murray,J., Sheet,P., Cordes,M.,
            Abu-Threideh,J., Stoneking,T., Kalicki,J., Graves,T., Harmon,G.,
            Edwards,J., Latreille,P., Courtney,L., Cloud,J., Abbott,A.,
            Scott,K., Johnson,D., Minx,P., Bentley,D., Fulton,B., Miller,N.,
            Greco,T., Kemp,K., Kramer,J., Fulton,L., Mardis,E., Dante,M.,
            Pepin,K., Hillier,L., Nelson,J., Spieth,J., Ryan,E., Andrews,S.,
            Geisel,C., Layman,D., Du,H., Ali,J., Berghoff,A., Jones,K.,
            Drone,K., Cotton,M., Joshu,C., Antonoiu,B., Zidanic,M., Strong,C.,
            Sun,H., Lamar,B., Yordan,C., Ma,P., Zhong,J., Preston,R., Vil,D.,
            Shekher,M., Matero,A., Shah,R., Swaby,I.K., O'Shaughnessy,A.,
            Rodriguez,M., Hoffmann,J., Till,S., Granat,S., Shohdy,N.,
            Hasegawa,A., Hameed,A., Lodhi,M., Johnson,A., Chen,E., Marra,M.,
            Martienssen,R. and McCombie,W.R.
  TITLE     Sequence and analysis of chromosome 4 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 769-777 (1999)
   PUBMED   10617198
REFERENCE   2  (bases 1 to 1116)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1116)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1116)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003075).
            
            On Sep 12, 2016 this sequence version replaced NM_119865.3.
FEATURES             Location/Qualifiers
     source          1..1116
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="4"
                     /ecotype="Columbia"
     gene            1..1116
                     /locus_tag="AT4G37020"
                     /db_xref="Araport:AT4G37020"
                     /db_xref="GeneID:829856"
                     /db_xref="TAIR:AT4G37020"
     CDS             158..796
                     /locus_tag="AT4G37020"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AA394779.1,INSD:BP866441.1,INSD:AI994890.1,
                     INSD:AA395164.1,INSD:EH808442.1,INSD:AU236641.1,
                     INSD:AU227596.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX828429.1,INSD:AK228495.1,INSD:AF325002.2"
                     /note="BEST Arabidopsis thaliana protein match is:
                     eukaryotic initiation factor 4A-III (TAIR:AT3G19760.1);
                     Has 30201 Blast hits to 17322 proteins in 780 species:
                     Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi -
                     3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="initiation factor 4A-like protein"
                     /protein_id="NP_568013.1"
                     /db_xref="GeneID:829856"
                     /db_xref="TAIR:AT4G37020"
                     /db_xref="Araport:AT4G37020"
                     /translation="MDSMEAPSLPFQSPSRSSQQLHFYLAVDRPQFKMETVVELLGVL
                     GRRPWLPIVVCCSSRDELDAVCSSLSTLPYISLAALYSDLADRERAMVIEKFRQATIN
                     WNQQLNSVVEEGLEESENGKEEKTSHLVVVTDVCLPLLSSGESSLSARVLINYELPTK
                     KETYTRRITTCLASGGIVINMVVGGEVTTLKSLEESSGILIAEMPINISEIL"
ORIGIN      
        1 cgatgttgtt tagatctgat acttacatat aaccaaacga cgacgttgct agagtaataa
       61 atctcaaaag actggaaacg actgcgtata agtccgtgac ctggttaccg gagcgtaact
      121 tctccggcga attggacaat tttgagaaag acggattatg gactccatgg aagctccatc
      181 tctaccattt caatctccct ctcgttccag tcaacaattg catttctacc tcgccgtgga
      241 tcgtccccaa ttcaaaatgg agactgtagt ggaattatta ggcgttctag gtcgtcgtcc
      301 atggcttccg attgtagtct gttgcagctc tcgtgacgaa cttgacgccg tctgttcttc
      361 cttatccact cttccttaca tttccttagc cgctttgtac agcgatctag cagatagaga
      421 acgagctatg gttatagaga aattcaggca agcaacaatc aactggaacc agcaacttaa
      481 ctctgtggta gaagaaggtt tggaagagag tgaaaacgga aaagaagaaa agacatctca
      541 tttggtagtt gtgaccgatg tttgccttcc gttactctca tcaggagaat cttctctatc
      601 cgcacgcgtt ctcataaact acgagcttcc tacaaagaag gaaacatata caaggcgtat
      661 aacaacttgc ttagcttcag gtggaatagt cataaacatg gttgttggag gtgaagtaac
      721 gactctcaaa agcctcgaag aaagcagtgg catactcatc gctgagatgc caatcaatat
      781 ttctgaaatc ttataacaac acatggatct ccgatctgaa gaattctaaa tggggttaat
      841 ggctcttaag ccttttgaag gactagagga gatgaatggt ggattgataa cgctttattt
      901 gtttgattgt atccagatgt ctcttgacca ttgcgctcaa atcatcaaag ccaaacttat
      961 tgtaaaacca gtttcttttt ttcttatatt attaaagaat gttgaaacga aagaaagttt
     1021 tgttctttct cttgtgtata ttatcaacat acatgtacat caaattgcaa ttttcttttg
     1081 tagctcccta ctagttaacc tatggtttag tacgta
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

More about the AT4G37020 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.