Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_146898.2
FASTA Graphics
LOCUS NM_146898 1297 bp mRNA linear ROD 26-OCT-2024 DEFINITION Mus musculus olfactory receptor family 4 subfamily C member 108 (Or4c108), mRNA. ACCESSION NM_146898 VERSION NM_146898.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1297) AUTHORS Olender,T., Jones,T.E.M., Bruford,E. and Lancet,D. TITLE A unified nomenclature for vertebrate olfactory receptors JOURNAL BMC Evol Biol 20 (1), 42 (2020) PUBMED 32295537 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1297) AUTHORS Young,J.M., Shykind,B.M., Lane,R.P., Tonnes-Priddy,L., Ross,J.A., Walker,M., Williams,E.M. and Trask,B.J. TITLE Odorant receptor expressed sequence tags demonstrate olfactory expression of over 400 genes, extensive alternate splicing and unequal expression levels JOURNAL Genome Biol 4 (11), R71 (2003) PUBMED 14611657 REFERENCE 3 (bases 1 to 1297) AUTHORS Young,J.M., Friedman,C., Williams,E.M., Ross,J.A., Tonnes-Priddy,L. and Trask,B.J. TITLE Different evolutionary processes shaped the mouse and human olfactory receptor gene families JOURNAL Hum Mol Genet 11 (5), 535-546 (2002) PUBMED 11875048 REMARK Erratum:[Hum Mol Genet. 2002 Jul 1;11(14):1683.] REFERENCE 4 (bases 1 to 1297) AUTHORS Zhang,X. and Firestein,S. TITLE The olfactory receptor gene superfamily of the mouse JOURNAL Nat Neurosci 5 (2), 124-133 (2002) PUBMED 11802173 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL928850.5. On Feb 26, 2010 this sequence version replaced NM_146898.1. Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: CB173616.1, CB173219.1 [ECO:0000332] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-210 AL928850.5 88945-89154 c 211-318 AL928850.5 84023-84130 c 319-1297 AL928850.5 81841-82819 c FEATURES Location/Qualifiers source 1..1297 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="2" /map="2 50.03 cM" gene 1..1297 /gene="Or4c108" /gene_synonym="Gm13762; MOR233-7; Olfr1213" /note="olfactory receptor family 4 subfamily C member 108" /db_xref="GeneID:258900" /db_xref="MGI:MGI:3031047" exon 1..210 /gene="Or4c108" /gene_synonym="Gm13762; MOR233-7; Olfr1213" /inference="alignment:Splign:2.1.0" exon 211..318 /gene="Or4c108" /gene_synonym="Gm13762; MOR233-7; Olfr1213" /inference="alignment:Splign:2.1.0" exon 319..1297 /gene="Or4c108" /gene_synonym="Gm13762; MOR233-7; Olfr1213" /inference="alignment:Splign:2.1.0" misc_feature 326..328 /gene="Or4c108" /gene_synonym="Gm13762; MOR233-7; Olfr1213" /note="upstream in-frame stop codon" CDS 362..1297 /gene="Or4c108" /gene_synonym="Gm13762; MOR233-7; Olfr1213" /note="olfactory receptor MOR233-7; GA_x6K02T2Q125-50452032-50451097" /codon_start=1 /product="olfactory receptor 1213" /protein_id="NP_667109.2" /db_xref="CCDS:CCDS16358.1" /db_xref="GeneID:258900" /db_xref="MGI:MGI:3031047" /translation="MQNQTLVTEFLLLGLSQNPKVQKIVFVVFLFIYIATVGGNMIIV VTIICSRALLGSPMYFFLACLSFLDACISSVITPKVTVDLLYEKRTISFEGCMAQVFA VHFFTGVEVIVLISMAYDRYVAICKPLYYSSIMNRRLCGILMGMAWTGGFLHSTIQIV FILCLPFCGPNVIDHFLCDLFPLLKLACTDTYIFVILVFANSGSFCIIIFSLLLISYG VILFSLRTHSTEGRRKALSTCGSHITVVVLFFVPCIIIYARPTSAFFSEKNMFLFATI LTPLLNPMIYTFRNKEMKNAIRKIWKKLILDYGIS" ORIGIN 1 tcatttttct attacttgga gatcatgatg agatgaatac actccttgtg aagcagagat 61 aatattaccc atacccattg ctagccttgt cctcacttct ctgccagcag agtatttttg 121 gtcaccactg aatgtgcact ttgcaataga gattagaaga tggctctcat caaatttttc 181 acacaactga tccacggaaa agcacataag ctgtattcaa attatttaat tatacccacc 241 ttgtaatgaa atgcttccat gaagaacttt ttgacatttt taaatgtggc cttattggtc 301 atgcttaaat actaccagat atagatgaac agattttcct ttgactgtat tgttgagaat 361 tatgcaaaac cagacccttg tcactgagtt cttacttctg ggactttcac agaatccaaa 421 ggttcagaaa atagtatttg ttgtattttt gttcatctac attgcaacag ttgggggcaa 481 catgataatt gtggtaacca tcatatgtag tcgtgcactt ctgggctccc ccatgtactt 541 cttcttggca tgcctgtcct ttctggatgc atgcatttcc tctgtcatca caccaaaggt 601 aactgtggac ttgctttatg agaagagaac catttctttt gaaggttgca tggcacaagt 661 ctttgctgtg cacttcttta ctggggtaga ggtgattgtc ttgatatcca tggcctatga 721 ccgctatgtg gccatttgta agcccttgta ctactcttcc attatgaaca ggaggctctg 781 tggaattctg atggggatgg cctggacagg aggcttcttg cattctacca tacaaattgt 841 cttcattttg tgtctgccct tttgtggccc caatgtgatt gatcattttt tgtgtgactt 901 gttcccatta ctgaagcttg cctgcactga cacatatatt tttgtcattt tggtgtttgc 961 taacagtggg tctttctgca tcattatttt ttccttgttg cttatttcct atggtgtcat 1021 tttgttctct ttgagaactc acagtacaga agggagacgt aaagctctct ctacctgtgg 1081 gtcccacatt actgttgtgg ttttgttctt tgtgccatgt ataataatat atgcaaggcc 1141 tacatctgcc tttttttctg aaaaaaacat gtttttattt gctactatcc tgacaccatt 1201 gctaaatcct atgatttaca ctttcaggaa taaggaaatg aagaatgcca taaggaaaat 1261 ttggaagaaa ttgatattgg attatggtat atcttaa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on