LOCUS NM_152430 3050 bp mRNA linear PRI 26-OCT-2024
DEFINITION Homo sapiens olfactory receptor family 51 subfamily E member 1
(OR51E1), mRNA.
ACCESSION NM_152430
VERSION NM_152430.4
KEYWORDS RefSeq; MANE Select.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3050)
AUTHORS Wei,J., Zhang,H., Ma,X., Li,Y., Zhou,W., Guo,J., Jin,T. and Hu,M.
TITLE Effect of OR51E1 single nucleotide polymorphisms on glioma
susceptibility in the Chinese Han population
JOURNAL Gene 875, 147489 (2023)
PUBMED 37207826
REMARK GeneRIF: Effect of OR51E1 single nucleotide polymorphisms on glioma
susceptibility in the Chinese Han population.
REFERENCE 2 (bases 1 to 3050)
AUTHORS Pronin,A. and Slepak,V.
TITLE Ectopically expressed olfactory receptors OR51E1 and OR51E2
suppress proliferation and promote cell death in a prostate cancer
cell line
JOURNAL J Biol Chem 296, 100475 (2021)
PUBMED 33640452
REMARK GeneRIF: Ectopically expressed olfactory receptors OR51E1 and
OR51E2 suppress proliferation and promote cell death in a prostate
cancer cell line.
REFERENCE 3 (bases 1 to 3050)
AUTHORS Luck,K., Kim,D.K., Lambourne,L., Spirohn,K., Begg,B.E., Bian,W.,
Brignall,R., Cafarelli,T., Campos-Laborie,F.J., Charloteaux,B.,
Choi,D., Cote,A.G., Daley,M., Deimling,S., Desbuleux,A., Dricot,A.,
Gebbia,M., Hardy,M.F., Kishore,N., Knapp,J.J., Kovacs,I.A.,
Lemmens,I., Mee,M.W., Mellor,J.C., Pollis,C., Pons,C.,
Richardson,A.D., Schlabach,S., Teeking,B., Yadav,A., Babor,M.,
Balcha,D., Basha,O., Bowman-Colin,C., Chin,S.F., Choi,S.G.,
Colabella,C., Coppin,G., D'Amata,C., De Ridder,D., De Rouck,S.,
Duran-Frigola,M., Ennajdaoui,H., Goebels,F., Goehring,L., Gopal,A.,
Haddad,G., Hatchi,E., Helmy,M., Jacob,Y., Kassa,Y., Landini,S.,
Li,R., van Lieshout,N., MacWilliams,A., Markey,D., Paulson,J.N.,
Rangarajan,S., Rasla,J., Rayhan,A., Rolland,T., San-Miguel,A.,
Shen,Y., Sheykhkarimli,D., Sheynkman,G.M., Simonovsky,E., Tasan,M.,
Tejeda,A., Tropepe,V., Twizere,J.C., Wang,Y., Weatheritt,R.J.,
Weile,J., Xia,Y., Yang,X., Yeger-Lotem,E., Zhong,Q., Aloy,P.,
Bader,G.D., De Las Rivas,J., Gaudet,S., Hao,T., Rak,J.,
Tavernier,J., Hill,D.E., Vidal,M., Roth,F.P. and Calderwood,M.A.
TITLE A reference map of the human binary protein interactome
JOURNAL Nature 580 (7803), 402-408 (2020)
PUBMED 32296183
REFERENCE 4 (bases 1 to 3050)
AUTHORS Jovancevic,N., Dendorfer,A., Matzkies,M., Kovarova,M.,
Heckmann,J.C., Osterloh,M., Boehm,M., Weber,L., Nguemo,F.,
Semmler,J., Hescheler,J., Milting,H., Schleicher,E., Gelis,L. and
Hatt,H.
TITLE Medium-chain fatty acids modulate myocardial function via a cardiac
odorant receptor
JOURNAL Basic Res Cardiol 112 (2), 13 (2017)
PUBMED 28116519
REMARK GeneRIF: These findings indicate that OR51E1 may play a role as
metabolic regulator of cardiac function
REFERENCE 5 (bases 1 to 3050)
AUTHORS Massberg,D., Jovancevic,N., Offermann,A., Simon,A., Baniahmad,A.,
Perner,S., Pungsrinont,T., Luko,K., Philippou,S., Ubrig,B.,
Heiland,M., Weber,L., Altmuller,J., Becker,C., Gisselmann,G.,
Gelis,L. and Hatt,H.
TITLE The activation of OR51E1 causes growth suppression of human
prostate cancer cells
JOURNAL Oncotarget 7 (30), 48231-48249 (2016)
PUBMED 27374083
REMARK GeneRIF: Results suggest the involvement of OR51E1 in growth
processes of PCa cells and its impact on AR-mediated signaling.
These findings provide novel evidences to support the functional
importance of ORs in PCa pathogenesis.
REFERENCE 6 (bases 1 to 3050)
AUTHORS Weng,J., Wang,J., Hu,X., Wang,F., Ittmann,M. and Liu,M.
TITLE PSGR2, a novel G-protein coupled receptor, is overexpressed in
human prostate cancer
JOURNAL Int J Cancer 118 (6), 1471-1480 (2006)
PUBMED 16206286
REMARK GeneRIF: Results suggest that PSGR2 may be useful as a tissue
marker and molecular target for the early detection and treatment
of human prostate cancers.
REFERENCE 7 (bases 1 to 3050)
AUTHORS Weigle,B., Fuessel,S., Ebner,R., Temme,A., Schmitz,M., Schwind,S.,
Kiessling,A., Rieger,M.A., Meye,A., Bachmann,M., Wirth,M.P. and
Rieber,E.P.
TITLE D-GPCR: a novel putative G protein-coupled receptor overexpressed
in prostate cancer and prostate
JOURNAL Biochem Biophys Res Commun 322 (1), 239-249 (2004)
PUBMED 15313197
REFERENCE 8 (bases 1 to 3050)
AUTHORS Malnic,B., Godfrey,P.A. and Buck,L.B.
TITLE The human olfactory receptor gene family
JOURNAL Proc Natl Acad Sci U S A 101 (8), 2584-2589 (2004)
PUBMED 14983052
REMARK Erratum:[Proc Natl Acad Sci U S A. 2004 May 4;101(18):7205]
REFERENCE 9 (bases 1 to 3050)
AUTHORS Vanti,W.B., Nguyen,T., Cheng,R., Lynch,K.R., George,S.R. and
O'Dowd,B.F.
TITLE Novel human G-protein-coupled receptors
JOURNAL Biochem Biophys Res Commun 305 (1), 67-71 (2003)
PUBMED 12732197
REMARK GeneRIF: This publication uses 'GPR136' as a name for this gene.
REFERENCE 10 (bases 1 to 3050)
AUTHORS Adams,M.D., Kerlavage,A.R., Fleischmann,R.D., Fuldner,R.A.,
Bult,C.J., Lee,N.H., Kirkness,E.F., Weinstock,K.G., Gocayne,J.D.,
White,O. et al.
TITLE Initial assessment of human gene diversity and expression patterns
based upon 83 million nucleotides of cDNA sequence
JOURNAL Nature 377 (6547 Suppl), 3-174 (1995)
PUBMED 7566098
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BC022401.1, AC090719.8 and AL833127.1.
On Nov 23, 2018 this sequence version replaced NM_152430.3.
Summary: Olfactory receptors interact with odorant molecules in the
nose, to initiate a neuronal response that triggers the perception
of a smell. The olfactory receptor proteins are members of a large
family of G-protein-coupled receptors (GPCR) arising from single
coding-exon genes. Olfactory receptors share a 7-transmembrane
domain structure with many neurotransmitter and hormone receptors
and are responsible for the recognition and G protein-mediated
transduction of odorant signals. The olfactory receptor gene family
is the largest in the genome. [provided by RefSeq, Jul 2008].
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: SRR1660807.64857.1, AL833127.1
[ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA1968189, SAMEA1968540
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
MANE Ensembl match :: ENST00000396952.6/ ENSP00000380155.5
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-1139 BC022401.1 57-1195
1140-3046 AC090719.8 53352-55258 c
3047-3050 AL833127.1 3048-3051
FEATURES Location/Qualifiers
source 1..3050
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11p15.4"
gene 1..3050
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="olfactory receptor family 51 subfamily E member 1"
/db_xref="GeneID:143503"
/db_xref="HGNC:HGNC:15194"
/db_xref="MIM:611267"
exon 1..49
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/inference="alignment:Splign:2.1.0"
exon 50..3050
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/inference="alignment:Splign:2.1.0"
CDS 89..1045
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="olfactory receptor, family 52, subfamily A, member
3 pseudogene; olfactory receptor, family 51, subfamily E,
member 1 pseudogene; Dresden-G-protein-coupled receptor;
prostate overexpressed G protein-coupled receptor;
olfactory receptor OR11-15; olfactory receptor 52A3;
G-protein coupled receptor 164; prostate-specific G
protein-coupled receptor 2"
/codon_start=1
/product="olfactory receptor 51E1"
/protein_id="NP_689643.2"
/db_xref="CCDS:CCDS31358.2"
/db_xref="GeneID:143503"
/db_xref="HGNC:HGNC:15194"
/db_xref="MIM:611267"
/translation="MMVDPNGNESSATYFILIGLPGLEEAQFWLAFPLCSLYLIAVLG
NLTIIYIVRTEHSLHEPMYIFLCMLSGIDILISTSSMPKMLAIFWFNSTTIQFDACLL
QMFAIHSLSGMESTVLLAMAFDRYVAICHPLRHATVLTLPRVTKIGVAAVVRGAALMA
PLPVFIKQLPFCRSNILSHSYCLHQDVMKLACDDIRVNVVYGLIVIISAIGLDSLLIS
FSYLLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPV
ILANIYLLVPPVLNPIVYGVKTKEIRQRILRLFHVATHASEP"
misc_feature 110..112
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q8TCB6.2); glycosylation site"
misc_feature 182..244
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="propagated from UniProtKB/Swiss-Prot (Q8TCB6.2);
transmembrane region"
misc_feature 269..331
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="propagated from UniProtKB/Swiss-Prot (Q8TCB6.2);
transmembrane region"
misc_feature 359..361
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q8TCB6.2); glycosylation site"
misc_feature 389..457
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="propagated from UniProtKB/Swiss-Prot (Q8TCB6.2);
transmembrane region"
misc_feature 524..586
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="propagated from UniProtKB/Swiss-Prot (Q8TCB6.2);
transmembrane region"
misc_feature 683..745
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="propagated from UniProtKB/Swiss-Prot (Q8TCB6.2);
transmembrane region"
misc_feature 806..868
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="propagated from UniProtKB/Swiss-Prot (Q8TCB6.2);
transmembrane region"
misc_feature 914..976
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="propagated from UniProtKB/Swiss-Prot (Q8TCB6.2);
transmembrane region"
regulatory 3019..3024
/regulatory_class="polyA_signal_sequence"
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="hexamer: AATAAA"
polyA_site 3050
/gene="OR51E1"
/gene_synonym="D-GPCR; DGPCR; GPR136; GPR164; OR51E1P;
OR52A3P; POGR; PSGR2"
/note="major polyA site"
ORIGIN
1 ggaggaagac tggacaaagg gggtcacaca ttccttccat acggttgagc ctctacctgc
61 ctggtgctgg tcacagttca gcttcttcat gatggtggat cccaatggca atgaatccag
121 tgctacatac ttcatcctaa taggcctccc tggtttagaa gaggctcagt tctggttggc
181 cttcccattg tgctccctct accttattgc tgtgctaggt aacttgacaa tcatctacat
241 tgtgcggact gagcacagcc tgcatgagcc catgtatata tttctttgca tgctttcagg
301 cattgacatc ctcatctcca cctcatccat gcccaaaatg ctggccatct tctggttcaa
361 ttccactacc atccagtttg atgcttgtct gctacagatg tttgccatcc actccttatc
421 tggcatggaa tccacagtgc tgctggccat ggcttttgac cgctatgtgg ccatctgtca
481 cccactgcgc catgccacag tacttacgtt gcctcgtgtc accaaaattg gtgtggctgc
541 tgtggtgcgg ggggctgcac tgatggcacc ccttcctgtc ttcatcaagc agctgccctt
601 ctgccgctcc aatatccttt cccattccta ctgcctacac caagatgtca tgaagctggc
661 ctgtgatgat atccgggtca atgtcgtcta tggccttatc gtcatcatct ccgccattgg
721 cctggactca cttctcatct ccttctcata tctgcttatt cttaagactg tgttgggctt
781 gacacgtgaa gcccaggcca aggcatttgg cacttgcgtc tctcatgtgt gtgctgtgtt
841 catattctat gtacctttca ttggattgtc catggtgcat cgctttagca agcggcgtga
901 ctctccgctg cccgtcatct tggccaatat ctatctgctg gttcctcctg tgctcaaccc
961 aattgtctat ggagtgaaga caaaggagat tcgacagcgc atccttcgac ttttccatgt
1021 ggccacacac gcttcagagc cctaggtgtc agtgatcaaa cttcttttcc attcagagtc
1081 ctctgattca gattttaatg ttaacatttt ggaagacagt attcagaaaa aaaatttcct
1141 taataaaaat acaactcaga tccttcaaat atgaaactgg ttggggaatc tccatttttt
1201 caatattatt ttcttctttg ttttcttgct acatataatt attaataccc tgactaggtt
1261 gtggttggag ggttattact tttcatttta ccatgcagtc caaatctaaa ctgcttctac
1321 tgatggttta cagcattctg agataagaat ggtacatcta gagaacattt gccaaaggcc
1381 taagcacggc aaaggaaaat aaacacagaa tataataaaa tgagataatc tagcttaaaa
1441 ctataacttc ctcttcagaa ctcccaacca cattggatct cagaaaaatg ctgtcttcaa
1501 aatgacttct acagagaaga aataattttt cctctggaca ctagcactta aggggaagat
1561 tggaagtaaa gccttgaaaa gagtacattt acctacgtta atgaaagttg acacactgtt
1621 ctgagagttt tcacagcata tggaccctgt ttttcctatt taattttctt atcaaccctt
1681 taattaggca aagatattat tagtaccctc attgtagcca tgggaaaatt gatgttcagt
1741 ggggatcagt gaattaaatg gggtcataca agtataaaaa ttaaaaaaaa aagacttcat
1801 gcccaatctc atatgatgtg gaagaactgt tagagagacc aacagggtag tgggttagag
1861 atttccagag tcttacattt tctagaggag gtatttaatt tcttctcact catccagtgt
1921 tgtatttagg aatttcctgg caacagaact catggcttta atcccactag ctattgctta
1981 ttgtcctggt ccaattgcca attacctgtg tcttggaaga agtgatttct aggttcacca
2041 ttatggaaga ttcttattca gaaagtctgc atagggctta tagcaagtta tttattttta
2101 aaagttccat aggtgattct gataggcagt gaggttaggg agccaccagt tatgatggga
2161 agtatggaat ggcaggtctt gaagataaca ttggcctttt gagtgtgact cgtagctgga
2221 aagtgaggga atcttcagga ccatgcttta tttggggctt tgtgcagtat ggaacaggga
2281 ctttgagacc aggaaagcaa tctgacttag gcatgggaat caggcatttt tgcttctgag
2341 gggctattac caagggttaa taggtttcat cttcaacagg atatgacaac agtgttaacc
2401 aagaaactca aattacaaat actaaaacat gtgatcatat atgtggtaag tttcattttc
2461 tttttcaatc ctcaggttcc ctgatatgga ttcctataac atgctttcat ccccttttgt
2521 aatggatatc atatttggaa atgcctattt aatacttgta tttgctgctg gactgtaagc
2581 ccatgagggc actgtttatt attgaatgtc atctctgttc atcattgact gctctttgct
2641 catcattgaa tcccccagca aagtgcctag aacataatag tgcttatgct tgacaccggt
2701 tatttttcat caaacctgat tccttctgtc ctgaacacat agccaggcaa ttttccagcc
2761 ttctttgagt tgggtattat taaattctgg ccattacttc caatgtgagt ggaagtgaca
2821 tgtgcaattt ctatacctgg ctcataaaac cctcccatgt gcagcctttc atgttgacat
2881 taaatgtgac ttgggaagct atgtgttaca cagagtaaat caccagaagc ctggatttct
2941 gaaaaaactg tgcagagcca aacctctgtc atttgcaact cccacttgta tttgtacgag
3001 gcagttggat aagtgaaaaa taaagtacta ttgtgtcaag tctctgaaaa
//