Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_JAHAWC010000064.1
FASTA Graphics
LOCUS NZ_JAHAWC010000064 236 bp DNA linear CON 14-JUN-2024 DEFINITION Enterobacter sp. 120016 contig00064, whole genome shotgun sequence. ACCESSION NZ_JAHAWC010000064 NZ_JAHAWC010000000 VERSION NZ_JAHAWC010000064.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN19079029 Assembly: GCF_018383635.1 KEYWORDS WGS; RefSeq. SOURCE Enterobacter sp. 120016 ORGANISM Enterobacter sp. 120016 Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter. REFERENCE 1 (bases 1 to 236) AUTHORS Wang,C., Wei,L., He,Y., Feng,Y. and Zong,Z. TITLE The draft genome of Enterobacter quasiasburiae strain 120016 JOURNAL Unpublished REFERENCE 2 (bases 1 to 236) AUTHORS Wang,C., Wei,L., He,Y., Feng,Y. and Zong,Z. TITLE Direct Submission JOURNAL Submitted (09-MAY-2021) Center of Infectious Diseases, West China Hospital, Sichuan University, Guoxuexiang 37, Chengdu, Sichuan 610041, China COMMENT REFSEQ INFORMATION: The reference sequence is identical to JAHAWC010000064.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: SPAdes v. 3.15.2 Genome Representation :: Full Expected Final Version :: No Genome Coverage :: 150.0x Sequencing Technology :: Illumina HiSeq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_018383635.1-RS_2024_06_14 Annotation Date :: 06/14/2024 04:58:37 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.7 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 4,650 CDSs (total) :: 4,554 Genes (coding) :: 4,508 CDSs (with protein) :: 4,508 Genes (RNA) :: 96 rRNAs :: 6, 6, 3 (5S, 16S, 23S) complete rRNAs :: 1 (5S) partial rRNAs :: 5, 6, 3 (5S, 16S, 23S) tRNAs :: 76 ncRNAs :: 5 Pseudo Genes (total) :: 46 CDSs (without protein) :: 46 Pseudo Genes (ambiguous residues) :: 0 of 46 Pseudo Genes (frameshifted) :: 15 of 46 Pseudo Genes (incomplete) :: 29 of 46 Pseudo Genes (internal stop) :: 7 of 46 Pseudo Genes (multiple problems) :: 4 of 46 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..236 /organism="Enterobacter sp. 120016" /mol_type="genomic DNA" /submitter_seqid="contig00064" /strain="120016" /isolation_source="blood" /host="Homo sapiens" /db_xref="taxon:2834878" /geo_loc_name="China: Chengdu, Sichuan" /collection_date="2018-08" gene complement(<1..>236) /locus_tag="KIF87_RS23500" /old_locus_tag="KIF87_23105" CDS complement(<1..>236) /locus_tag="KIF87_RS23500" /old_locus_tag="KIF87_23105" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_008500123.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="filamentous hemagglutinin N-terminal domain-containing protein" /protein_id="WP_213330873.1" /translation="NGAGISHNQFGEYNVGKEGLILNNGTDRLTQTQLGGLIQNNPNL QAGREAKGIINEVTGASRSQLQGYTEVAGKAANV" CONTIG join(JAHAWC010000064.1:1..236) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on