U.S. flag

An official website of the United States government

Enterobacter sp. 120016 contig00064, whole genome shotgun sequence

NCBI Reference Sequence: NZ_JAHAWC010000064.1

FASTA Graphics 

LOCUS       NZ_JAHAWC010000064       236 bp    DNA     linear   CON 14-JUN-2024
DEFINITION  Enterobacter sp. 120016 contig00064, whole genome shotgun sequence.
ACCESSION   NZ_JAHAWC010000064 NZ_JAHAWC010000000
VERSION     NZ_JAHAWC010000064.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN19079029
            Assembly: GCF_018383635.1
KEYWORDS    WGS; RefSeq.
SOURCE      Enterobacter sp. 120016
  ORGANISM  Enterobacter sp. 120016
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Enterobacterales; Enterobacteriaceae; Enterobacter.
REFERENCE   1  (bases 1 to 236)
  AUTHORS   Wang,C., Wei,L., He,Y., Feng,Y. and Zong,Z.
  TITLE     The draft genome of Enterobacter quasiasburiae strain 120016
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 236)
  AUTHORS   Wang,C., Wei,L., He,Y., Feng,Y. and Zong,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2021) Center of Infectious Diseases, West China
            Hospital, Sichuan University, Guoxuexiang 37, Chengdu, Sichuan
            610041, China
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            JAHAWC010000064.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: SPAdes v. 3.15.2
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 150.0x
            Sequencing Technology  :: Illumina HiSeq
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_018383635.1-RS_2024_06_14
            Annotation Date                   :: 06/14/2024 04:58:37
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.7
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 4,650
            CDSs (total)                      :: 4,554
            Genes (coding)                    :: 4,508
            CDSs (with protein)               :: 4,508
            Genes (RNA)                       :: 96
            rRNAs                             :: 6, 6, 3 (5S, 16S, 23S)
            complete rRNAs                    :: 1 (5S)
            partial rRNAs                     :: 5, 6, 3 (5S, 16S, 23S)
            tRNAs                             :: 76
            ncRNAs                            :: 5
            Pseudo Genes (total)              :: 46
            CDSs (without protein)            :: 46
            Pseudo Genes (ambiguous residues) :: 0 of 46
            Pseudo Genes (frameshifted)       :: 15 of 46
            Pseudo Genes (incomplete)         :: 29 of 46
            Pseudo Genes (internal stop)      :: 7 of 46
            Pseudo Genes (multiple problems)  :: 4 of 46
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..236
                     /organism="Enterobacter sp. 120016"
                     /mol_type="genomic DNA"
                     /submitter_seqid="contig00064"
                     /strain="120016"
                     /isolation_source="blood"
                     /host="Homo sapiens"
                     /db_xref="taxon:2834878"
                     /geo_loc_name="China: Chengdu, Sichuan"
                     /collection_date="2018-08"
     gene            complement(<1..>236)
                     /locus_tag="KIF87_RS23500"
                     /old_locus_tag="KIF87_23105"
     CDS             complement(<1..>236)
                     /locus_tag="KIF87_RS23500"
                     /old_locus_tag="KIF87_23105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008500123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="filamentous hemagglutinin N-terminal
                     domain-containing protein"
                     /protein_id="WP_213330873.1"
                     /translation="NGAGISHNQFGEYNVGKEGLILNNGTDRLTQTQLGGLIQNNPNL
                     QAGREAKGIINEVTGASRSQLQGYTEVAGKAANV"
CONTIG      join(JAHAWC010000064.1:1..236)
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.