LOCUS NZ_JAHZQF010000025 820 bp DNA linear CON 22-NOV-2024
DEFINITION Streptococcus gordonii strain KK1 Sgordonii_KK1_Nina_Sia_YES_25,
whole genome shotgun sequence.
ACCESSION NZ_JAHZQF010000025 NZ_JAHZQF010000000
VERSION NZ_JAHZQF010000025.1
DBLINK BioProject: PRJNA224116
BioSample: SAMN20399915
Assembly: GCF_019929835.1
KEYWORDS WGS; RefSeq.
SOURCE Streptococcus gordonii
ORGANISM Streptococcus gordonii
Bacteria; Bacillati; Bacillota; Bacilli; Lactobacillales;
Streptococcaceae; Streptococcus.
REFERENCE 1 (bases 1 to 820)
AUTHORS Cross,B., Thamadilok,S., Bensing,B., Sasmal,A., Khedri,Z., Deng,L.,
Yu,H., Mehta,A., Aluvathingal,J., Nadendla,S., Vickerman,M.,
Chen,X., Dewhirst,F., Gill,A., Lettrichova,I., Diaz,S., Gill,S.,
Tettelin,H., Iverson,T., Sullam,P., Varki,A. and Ruhl,S.
TITLE Occurrence of streptococci in the human mouth that bind to a
non-human glycan
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 820)
AUTHORS Cross,B., Thamadilok,S., Bensing,B., Sasmal,A., Khedri,Z., Deng,L.,
Yu,H., Mehta,A., Aluvathingal,J., Nadendla,S., Vickerman,M.,
Chen,X., Dewhirst,F., Gill,A., Lettrichova,I., Diaz,S., Gill,S.,
Tettelin,H., Iverson,T., Sullam,P., Varki,A. and Ruhl,S.
TITLE Direct Submission
JOURNAL Submitted (29-JUL-2021) Department of Oral Biology, University at
Buffalo School of Dental Medicine, 3435 Main St., Foster Hall,
Buffalo, NY 14214, USA
COMMENT REFSEQ INFORMATION: The reference sequence is identical to
JAHZQF010000025.1.
The annotation was added by the NCBI Prokaryotic Genome Annotation
Pipeline (PGAP). Information about PGAP can be found here:
https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
##Genome-Assembly-Data-START##
Assembly Method :: A5-miseq v. 2015-05-22
Genome Coverage :: 520x
Sequencing Technology :: Illumina
##Genome-Assembly-Data-END##
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Name :: GCF_019929835.1-RS_2024_11_19
Annotation Date :: 11/19/2024 02:38:09
Annotation Pipeline :: NCBI Prokaryotic Genome
Annotation Pipeline (PGAP)
Annotation Method :: Best-placed reference protein
set; GeneMarkS-2+
Annotation Software revision :: 6.9
Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA
Genes (total) :: 2,275
CDSs (total) :: 2,211
Genes (coding) :: 2,137
CDSs (with protein) :: 2,137
Genes (RNA) :: 64
rRNAs :: 3, 4, 1 (5S, 16S, 23S)
complete rRNAs :: 3, 1, 1 (5S, 16S, 23S)
partial rRNAs :: 3 (16S)
tRNAs :: 53
ncRNAs :: 3
Pseudo Genes (total) :: 74
CDSs (without protein) :: 74
Pseudo Genes (ambiguous residues) :: 0 of 74
Pseudo Genes (frameshifted) :: 16 of 74
Pseudo Genes (incomplete) :: 61 of 74
Pseudo Genes (internal stop) :: 11 of 74
Pseudo Genes (multiple problems) :: 10 of 74
CRISPR Arrays :: 1
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..820
/organism="Streptococcus gordonii"
/mol_type="genomic DNA"
/submitter_seqid="Sgordonii_KK1_Nina_Sia_YES_25"
/strain="KK1"
/isolation_source="dental plaque"
/host="Pan troglodytes"
/db_xref="taxon:1302"
/geo_loc_name="USA: Buffalo, NY"
/lat_lon="42.9 N 78.8 W"
/collection_date="2010-09-30"
/collected_by="Supaporn Thamadilok"
gene <1..373
/locus_tag="K1I55_RS11080"
/old_locus_tag="K1I55_11040"
CDS <1..373
/locus_tag="K1I55_RS11080"
/old_locus_tag="K1I55_11040"
/inference="COORDINATES: similar to AA
sequence:RefSeq:WP_004184459.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=2
/transl_table=11
/product="nucleotidyltransferase family protein"
/protein_id="WP_223355391.1"
/translation="AEAARIELEAKLKADWPQYRWELRNQAYMHRHSPGTAPYKNARE
AMSKYPERCTTIGLRLLANDKLELFAPYGLKDILNFQVRPTPHFLENKERQRVYAERL
AKKNWQKRWPQLEYHYPNKWV"
gene 645..>820
/locus_tag="K1I55_RS11085"
/old_locus_tag="K1I55_11045"
/pseudo
CDS 645..>820
/locus_tag="K1I55_RS11085"
/old_locus_tag="K1I55_11045"
/inference="COORDINATES: similar to AA
sequence:RefSeq:WP_000737444.1"
/note="incomplete; too short partial abutting assembly
gap; missing C-terminus; Derived by automated
computational analysis using gene prediction method:
Protein Homology."
/pseudo
/codon_start=1
/transl_table=11
/product="low molecular weight phosphotyrosine protein
phosphatase"
CONTIG join(JAHZQF010000025.1:1..820)
//