U.S. flag

An official website of the United States government

Streptococcus gordonii strain KK1 Sgordonii_KK1_Nina_Sia_YES_25, whole genome shotgun sequence

NCBI Reference Sequence: NZ_JAHZQF010000025.1

FASTA Graphics 

LOCUS       NZ_JAHZQF010000025       820 bp    DNA     linear   CON 22-NOV-2024
DEFINITION  Streptococcus gordonii strain KK1 Sgordonii_KK1_Nina_Sia_YES_25,
            whole genome shotgun sequence.
ACCESSION   NZ_JAHZQF010000025 NZ_JAHZQF010000000
VERSION     NZ_JAHZQF010000025.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN20399915
            Assembly: GCF_019929835.1
KEYWORDS    WGS; RefSeq.
SOURCE      Streptococcus gordonii
  ORGANISM  Streptococcus gordonii
            Bacteria; Bacillati; Bacillota; Bacilli; Lactobacillales;
            Streptococcaceae; Streptococcus.
REFERENCE   1  (bases 1 to 820)
  AUTHORS   Cross,B., Thamadilok,S., Bensing,B., Sasmal,A., Khedri,Z., Deng,L.,
            Yu,H., Mehta,A., Aluvathingal,J., Nadendla,S., Vickerman,M.,
            Chen,X., Dewhirst,F., Gill,A., Lettrichova,I., Diaz,S., Gill,S.,
            Tettelin,H., Iverson,T., Sullam,P., Varki,A. and Ruhl,S.
  TITLE     Occurrence of streptococci in the human mouth that bind to a
            non-human glycan
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 820)
  AUTHORS   Cross,B., Thamadilok,S., Bensing,B., Sasmal,A., Khedri,Z., Deng,L.,
            Yu,H., Mehta,A., Aluvathingal,J., Nadendla,S., Vickerman,M.,
            Chen,X., Dewhirst,F., Gill,A., Lettrichova,I., Diaz,S., Gill,S.,
            Tettelin,H., Iverson,T., Sullam,P., Varki,A. and Ruhl,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-2021) Department of Oral Biology, University at
            Buffalo School of Dental Medicine, 3435 Main St., Foster Hall,
            Buffalo, NY 14214, USA
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            JAHZQF010000025.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: A5-miseq v. 2015-05-22
            Genome Coverage       :: 520x
            Sequencing Technology :: Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_019929835.1-RS_2024_11_19
            Annotation Date                   :: 11/19/2024 02:38:09
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.9
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 2,275
            CDSs (total)                      :: 2,211
            Genes (coding)                    :: 2,137
            CDSs (with protein)               :: 2,137
            Genes (RNA)                       :: 64
            rRNAs                             :: 3, 4, 1 (5S, 16S, 23S)
            complete rRNAs                    :: 3, 1, 1 (5S, 16S, 23S)
            partial rRNAs                     :: 3 (16S)
            tRNAs                             :: 53
            ncRNAs                            :: 3
            Pseudo Genes (total)              :: 74
            CDSs (without protein)            :: 74
            Pseudo Genes (ambiguous residues) :: 0 of 74
            Pseudo Genes (frameshifted)       :: 16 of 74
            Pseudo Genes (incomplete)         :: 61 of 74
            Pseudo Genes (internal stop)      :: 11 of 74
            Pseudo Genes (multiple problems)  :: 10 of 74
            CRISPR Arrays                     :: 1
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..820
                     /organism="Streptococcus gordonii"
                     /mol_type="genomic DNA"
                     /submitter_seqid="Sgordonii_KK1_Nina_Sia_YES_25"
                     /strain="KK1"
                     /isolation_source="dental plaque"
                     /host="Pan troglodytes"
                     /db_xref="taxon:1302"
                     /geo_loc_name="USA: Buffalo, NY"
                     /lat_lon="42.9 N 78.8 W"
                     /collection_date="2010-09-30"
                     /collected_by="Supaporn Thamadilok"
     gene            <1..373
                     /locus_tag="K1I55_RS11080"
                     /old_locus_tag="K1I55_11040"
     CDS             <1..373
                     /locus_tag="K1I55_RS11080"
                     /old_locus_tag="K1I55_11040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004184459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=2
                     /transl_table=11
                     /product="nucleotidyltransferase family protein"
                     /protein_id="WP_223355391.1"
                     /translation="AEAARIELEAKLKADWPQYRWELRNQAYMHRHSPGTAPYKNARE
                     AMSKYPERCTTIGLRLLANDKLELFAPYGLKDILNFQVRPTPHFLENKERQRVYAERL
                     AKKNWQKRWPQLEYHYPNKWV"
     gene            645..>820
                     /locus_tag="K1I55_RS11085"
                     /old_locus_tag="K1I55_11045"
                     /pseudo
     CDS             645..>820
                     /locus_tag="K1I55_RS11085"
                     /old_locus_tag="K1I55_11045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000737444.1"
                     /note="incomplete; too short partial abutting assembly
                     gap; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="low molecular weight phosphotyrosine protein
                     phosphatase"
CONTIG      join(JAHZQF010000025.1:1..820)
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.