Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_JJNY01000155.1
FASTA Graphics
LOCUS NZ_JJNY01000155 2136 bp DNA linear CON 15-FEB-2024 DEFINITION Pseudoalteromonas sp. S3431 contig0159, whole genome shotgun sequence. ACCESSION NZ_JJNY01000155 NZ_JJNY01000000 VERSION NZ_JJNY01000155.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN02708826 Assembly: GCF_000690035.1 KEYWORDS WGS; RefSeq. SOURCE Pseudoalteromonas sp. S3431 ORGANISM Pseudoalteromonas sp. S3431 Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Alteromonadales; Pseudoalteromonadaceae; Pseudoalteromonas. REFERENCE 1 (bases 1 to 2136) AUTHORS Machado,H.R., Gram,L. and Vynne,N.G. TITLE Pseudoalteromonas galatheae sp. nov., isolated from a deep-sea polychaete near Canal Concepcion, Chile JOURNAL Unpublished REFERENCE 2 (bases 1 to 2136) AUTHORS Machado,H.R., Gram,L. and Vynne,N.G. TITLE Direct Submission JOURNAL Submitted (04-APR-2014) Department of Systems Biology, Technical University of Denmark, Matematiktorvet, Building 301, Kgs. Lyngby DK-2800, Denmark COMMENT REFSEQ INFORMATION: The reference sequence is identical to JJNY01000155.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Date :: APR-2014 Assembly Method :: CLC NGS Cell v. 7 Assembly Name :: Pgalathea Genome Representation :: Full Expected Final Version :: No Genome Coverage :: 130.0x Sequencing Technology :: Illumina HiSeq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Date :: 02/15/2024 02:29:16 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.6 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 3,721 CDSs (total) :: 3,625 Genes (coding) :: 3,595 CDSs (with protein) :: 3,595 Genes (RNA) :: 96 rRNAs :: 2, 1, 1 (5S, 16S, 23S) complete rRNAs :: 2, 1, 1 (5S, 16S, 23S) tRNAs :: 88 ncRNAs :: 4 Pseudo Genes (total) :: 30 CDSs (without protein) :: 30 Pseudo Genes (ambiguous residues) :: 0 of 30 Pseudo Genes (frameshifted) :: 6 of 30 Pseudo Genes (incomplete) :: 25 of 30 Pseudo Genes (internal stop) :: 7 of 30 Pseudo Genes (multiple problems) :: 7 of 30 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2136 /organism="Pseudoalteromonas sp. S3431" /mol_type="genomic DNA" /submitter_seqid="contig0159" /strain="S3431" /isolation_source="deep-sea polychaete" /db_xref="taxon:579537" /geo_loc_name="Chile: Canal Concepcion" /lat_lon="50.4498 S 74.8912 W" /collection_date="2007-02-03" gene 222..1931 /locus_tag="DO88_RS00030" /old_locus_tag="DO88_19090" CDS 222..1931 /locus_tag="DO88_RS00030" /old_locus_tag="DO88_19090" /EC_number="2.3.1.-" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_008134721.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="GNAT family N-acyltransferase" /protein_id="WP_033041286.1" /translation="MISIDKVIAANLPQLEKSPKVKGLVKKGLGYLLHEQEFVAFGDA YPHLQGLEFVEQVLDELDFDTRYKPKQIEHIPNEGKLVIVANHPIGSLDALALIKVLS TVRQDLKVVANRMLMSVTPMHELLLPVDNLSGTSKKQELNNIHQHLKNEGALLIFPAG EVSRLSPTGIKDCKWNSGFLRMAKKANCPILPVFIKAKNSPLFYGTSMIYKPLASLLL VKEMFKQRQKSLEFEIGASIPPESYLIENLKDKEVVNLIRKQLYRLTSKKPLPLKTQM PLAIPECRKELKKAIDQCQLLGKTIDDMHIHLYQYTGSSAVFRELGRLREIAFRAVGE GSGKRRDIDKYDMDYQHLVLWDPTQLELVGAYRLACAQDIIKKHGRKGLYTDSLFSYT EAMTPYLHQGIELGRSFVQPKYWGRKSLDYLWYGIGAFIKNYPQYRYLFGAVTVPNTL PEQAKAMLVYYYQHYYKNNVQLAMPNNEFRLSDQQLTQCQTVFSGNNVKEDFVELKHV LANMGAQVPTLFKQYTELCMPGGVQFLSFSIDPDFNNCIDGLVLVDLESVKENKAKRY LKK" CONTIG join(JJNY01000155.1:1..2136) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on